SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_40950 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_40950
Domain Number - Region: 192-232
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0647
Family PHD domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_40950
Sequence length 300
Comment | Brugia malayi conserved hypothetical protein (301 aa)
Sequence
MSKKRVKIPPENFQNNSSQATTNNIVVSFGTATNSGIYFYGFNSNASTRNNALSFQTGTN
SNTDPCGSGSNVSTGNDIFSSKKTTITDNSKNFQKEYIVSRTTTNDNIDPCGSGSNASTG
NNADLLSNTTQTVNLCTSSNQIITFFLQFFALVQKLINEQRKLRQQILQQVIAQEIRALS
QQFNEQQQKRPRSIHICDLCKKEVHSSKLPCHVRMAHLKIPIYFCTKCNKSSNYSKNNIK
THMTRIHKIVDPQPIDYAHLHALKVRSLMKKCFPKVKSRSALNNFGYFPIIDMAESDDSD
Download sequence
Identical sequences A0A0K0IPV8
Bm1_40950 XP_001899650.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]