SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_41035 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_41035
Domain Number 1 Region: 49-243
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.5e-48
Family Astacin 0.00065
Further Details:      
 
Domain Number 2 Region: 287-403
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 405-440
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000327
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  Bm1_41035
Domain Number - Region: 248-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0116
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_41035
Sequence length 497
Comment | Brugia malayi Zinc metalloproteinase toh-2 precursor,
Sequence
putativeXXXXaaXMEGDIVLDAQQAHEIYESMIQHGRRTKRKFIRSELRRWDSHKPII
YSFDGSHTIREQRVIELALEHWHNITCLNFERRDDEIQENRIVFTDVDGCASNVGRHPLG
EPQFVSLAPECIRLGVIAHEVAHALGFWHEQSRPDRDNYVTVRWENIDRDSKGQFLKELP
TDVDNGDVPYDYGSIMHYRSKAFGRYEDLFTLNTNIMDYQKTIGQRDQLSFNDIRLMNVI
YCSDSCAQKLPCQRGGYTDPRRCGRCRCPDGFTGKLCERIMPGFGADCGGRIELTSSWKR
ITSPNYPRDFKEGQECSWLLVAPPGQRVQLRFYGEFEMYCKVRHSLCMDYIEIRNSTDFA
NTGMRYCCYGTPKSSIMSATEDMLVLFRSFYRGGKGFQAQVRALPTTGLFLAWSEWSACN
ASYGAQHRIRHRRRICVDGACIQGGYSDKGVQDVSVILFFYFLWFASMKHETMFNIRTVR
SMDEFNANLNKHAVADS
Download sequence
Identical sequences Bm1_41035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]