SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_41080 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_41080
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.99e-34
Family Astacin 0.0011
Further Details:      
 
Domain Number 2 Region: 208-314
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000183
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_41080
Sequence length 319
Comment | Brugia malayi Nematode astacin protease protein 30, putative (320 aa)
Sequence
MWEEATCLRFQENLQARDAIRYVLERGDSCFTEYIGRNGGYQDIIIGSECAEEYVVAHET
GHALGFWHTHQRPDRDRYISINWKNVMDEATASFMPFRSMLQAFGIRQISPRRIPYDYGS
LMHYHAVAHAVRVSDFTIVPKELKYVTTMGTEKMAFLDAKVINDIYCLNACAGRRLRRCL
AGGYPDPNNCNRCRCPEGLGGYDCSILQPSTCGAELHATDKWQTLTSPKGGNIDCYWRIS
VPAGNRVRFRLSDGEFPCSYGCQSYVEIKHKLDIRLTGFRSCCYRPKEDSISESNQIFVI
FHPNGKMARFTLRYIRQQL
Download sequence
Identical sequences XP_001899677.1.25112 Bm1_41080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]