SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_41215 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_41215
Domain Number 1 Region: 16-135,230-318
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.15e-41
Family Ankyrin repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  Bm1_41215
Domain Number - Region: 111-197
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00257
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_41215
Sequence length 521
Comment | Brugia malayi conserved hypothetical protein (522 aa)
Sequence
MDIIELKETNESGRIKAFLDAAYRADYEAISDNLAHGLSADIMDDDNTTALQIASAQGNL
AMMQILLNRGASVDKCNHCGFTPLLHAARNGKVQAIELLIRHGANPFRTTFYGTTALSLA
SSRGHLNVLVMLREYASETRRRAPTPLIAAIATKQYQIVIHLEFAGFIRHPCCDVFYELD
AFHVAEQLMDLKMIALLHDLDLQLLNQPAVYCITSRTFTNRESQVEIPRKTADIRCLIRD
HKVALVDYIMNLNDYAELPTGTTPLMYAAIVGSISMVQILLQHNCNINASYYGFTPIMIA
IVCGNDALTQYLVKKGASQSTNGCQFSLFELASNSDGISSSTIQMLLKGSGHKMRLIKRM
AATLQKISRIRGKSQSMCHQPIKLVIGASQQSFLQKVVQNMGMKSNWVPKELFSALAWPD
SPCTCFEVSGTPNGFKTNPKPVLEERIMVNTDEQEQCRCLMNDCCLRKRTTKDGSLAQSS
NFHTTPSLVNTNYLHIRQQQCNSISKLQSILFHFGSGSPKK
Download sequence
Identical sequences Bm1_41215 XP_001899700.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]