SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_42270 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_42270
Domain Number 1 Region: 605-858
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.03e-50
Family Ankyrin repeat 0.0000424
Further Details:      
 
Domain Number 2 Region: 173-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000914
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 3 Region: 13-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000218
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 51-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000522
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 239-270
Classification Level Classification E-value
Superfamily Notch domain 0.00000109
Family Notch domain 0.0026
Further Details:      
 
Domain Number 6 Region: 131-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 7 Region: 93-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000392
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 318-349
Classification Level Classification E-value
Superfamily Notch domain 0.00000484
Family Notch domain 0.0069
Further Details:      
 
Domain Number 9 Region: 281-311
Classification Level Classification E-value
Superfamily Notch domain 0.0000732
Family Notch domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_42270
Sequence length 994
Comment | Brugia malayi EGF-like domain containing protein (995 aa)
Sequence
MSGNNFIQKDTVISYCEKPSNNLCENGGTCVNVGPNDYECVCLNGYSGKNCSRDEDDCIE
NSCAIGSTCIDGIAKYTCACPPGRIGLFCHLDDPCMQKPCGNGSECIPDTASGEFSCNCM
KGTTGQNCTTDINECLENEKLCFNGGICVNTFGSWYCDCPLGYNDPYCMIHDNECEPNPC
LNGASCLDYGNRYECICQNTFYGTNCEKICPPGFEGRMCKQHRISLENNHLEELFEEQIC
LLHNCSSKADNNICDSECNYPSCQYDGFDCTAHLQPFRLCPFSDFCGRVFHDNKCDSVCD
RFECLLDGFDCHEKSETCLFEDYCSARFNDGYCDYECFTEECYFDGVDCTQEIKYNKLEG
ALSLIILMKSDEFLKRAPVLQFILSQGMRARVTIAVDRHNHKRLYSWKSDAKGLHGTKVY
LNVETAQCRKGANCQHQISNIEQAVNFVGAMSANQLLWRVGARIHAAEAELSSSTTIWKK
WMVYTLSGFVMQTFVIAILFTLHKKHRNTTRQLQKKVHVVGTWFPPTLDDYFPLKLFKES
NGNIQSNGIPSKKVNEDEQKHHFIEVCVIPDPEEEKICKRKWTVLHTQAMDSFAIKTPID
KLLVNTKSNDGKTALMLTALNQEKAEEISCTDVENLFLAGALVDAVDDCGQTALIMAIKA
GRAEVVKCLLRFGADTAISDIHSRTTLHHAASINAADIIRILLETEEIEAFQGSSLDFML
IKVDAIDDADCSPLMTVAKLGYRDPEAIALLIDAGADINCTGNHVNGEMYKGRTALHYAI
MQSNQELARYLVERGANLNIQDHMGQTPLFLAASQGHVEMVHMLVTAGARRYIPDNMDQT
PEEIANYKEYREVVQYFXNLRMQNDSVTNGNGRSKSRNVKKPRLVTISPTPLEMILNTTA
MTPESSNSSNSSSFFDHFKEYYNLSSHVPCEVNAQVPSLPNTIPQQNSQHFVQIPYSSMN
HMANQNYNMRNSCLTINENRPVSSTSLLEFEHYV
Download sequence
Identical sequences Bm1_42270 XP_001899918.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]