SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_42495 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_42495
Domain Number 1 Region: 469-637
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.8e-38
Family Ankyrin repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_42495
Sequence length 658
Comment | Brugia malayi VAB-19, putative (659 aa)
Sequence
MTDAVELVDSETGSKQSIPLFKDSSSMTTPITSHSRHIQTEQIKTRTVCISTSPMCLLNH
NIGTVQVTQKDSYTVCGELMTRDFVDAFTGMDIEEIGQRICYTTVASQTEFEQSEPRVID
DREIAESLWLIPSRDRKDVAVGNEDDVIEVHEIPPPAXDGINHQKEMMLDSDDDDMICVI
EETLSDPEDIDFKSAKSAEQLSLEQRIADNLDVKTRNEVAAKVKTPRALGHARAAIVKKM
LTEKSQPLNFIRGTAISKSWRSASKKGDPLXYIVDQHETQRNSDSSTPQTTKDALKEKVN
LKRDFVSPQMELSKVPEPEAEIADRLTPLRSEMRTLRTYSNGRAVTFPRSAQLLKNVPPK
ISSPGYXKTNNSIVFEDSTSSSSDSEGSYDTNEASTAAQFELTLQLNEAIGILKNHFQKS
DPFESSLLDWATNHAKHEWLKTAARKTASAVEVEGFIDMLEATSDAVLKFVINLADPNGN
TALHYAISHGNFDVVSVLLDSRVCNLDRANKAGYTPVMLASLYDASDEVETAIIHRLFQL
GDVNAQAVQHGQTALMLAVSHGKINTTKLLIDCQADLNIQDEEGSTALMCAAEHGHKEIV
KLLLLQKDIDASLSDCDSSTALSIAVENGHRDIGVLIYAHLNHSCKQNQKQQKIELTS
Download sequence
Identical sequences Bm1_42495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]