SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_42725 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_42725
Domain Number 1 Region: 45-126
Classification Level Classification E-value
Superfamily Immunoglobulin 4.23e-17
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_42725
Sequence length 136
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (137 aa)
Sequence
MEARGGRRAGKSKGKSNLQFAQVAEFSLVHTQLADSKSAHIVTGSHFSQTFRLGYKLVLI
CKAKGTPRPTIKWYKEGAEMLPKKNTHHYEKLLDEDMLWSKLEIDPATMGDQGIYACVAN
NEHGVMAKNFKAEYTY
Download sequence
Identical sequences J9ECH1
XP_001900008.1.25112 WUBG_08961T0 Bm1_42725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]