SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_42830 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_42830
Domain Number 1 Region: 70-229
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000311
Family Ankyrin repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_42830
Sequence length 230
Comment | Brugia malayi hypothetical protein (231 aa)
Sequence
MVHQHRLCLVCYAFCTEGELKVCNELGVQHWMHADCYHSWKEACCHCNILYSASSHFTLF
PYKFLDVTVDGECLLFAVEANDAFSVRVLLHHGAPISFQKKSGEKIDSLSVAFILGNCAS
AEEILKFLNYRSTRMQEFMRNRLLEFINHHDYRVVDLLLAYGANIYDRSEKGKSVFHRMT
QNNDQQLAIATATKLFEKTVIVPSFIDAEDYRHRTALQLACARCHWKLAE
Download sequence
Identical sequences XP_001900028.1.25112 Bm1_42830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]