SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_42850 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_42850
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-19
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_42850
Sequence length 125
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (126 aa)
Sequence
MEDGSSPSKRPYIRLTSFLNNVTKNAGDEVRFKCEAAGSPLPLQFSWLKNHAPVEKNRKL
KIKNREYWSRLVITDLEVLDSGYYQCVVSNSLASVNTTAVLRSKPLVQFPYKRNKKLNYS
DVSVN
Download sequence
Identical sequences A0A0R3Q3C6
Bm1_42850 XP_001900032.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]