SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_42980 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_42980
Domain Number 1 Region: 4-90
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-16
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_42980
Sequence length 107
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (108 aa)
Sequence
MSLAPFFDKAPSIINKPDGSVLFECMCNANPEPTIQWFFKDKELSGDRYTMKIKKMVGKW
TCTMTMKNPTLQDQGVYKVVATNKNGTHSVEQNYVLSCTANEVFKTQ
Download sequence
Identical sequences A0A0K0JN47 A0A0N4TVF0 A0A0R3QMD2
XP_001900058.1.25112 Bm1_42980 Bm6430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]