SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_43320 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_43320
Domain Number 1 Region: 85-104,132-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-22
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 2 Region: 352-432
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000162
Family Laminin G-like module 0.0073
Further Details:      
 
Weak hits

Sequence:  Bm1_43320
Domain Number - Region: 63-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_43320
Sequence length 443
Comment | Brugia malayi Thrombospondin N-terminal -like domain
Sequence
containingproteinXXXXaaXMIPKNQTIRGRIVGGAEARILEYIIARNFLSAHCSQ
NICVKSCLNGNSCLLDATTDDKPLCQCIQHFNGQLCEQQICRSSEICGDNSSNTKMMSEE
QLNMKLNHAVPLFAGDGFLSEKLVMDVKEKLEIEIWLKAMNPDGLVFYWTNLDATTRQYT
DGYFIALVLIFSXPHFFWNFGSGIIYSRSTASVLNDQFHSIHFEKYFRSGSLQVNDEQSD
TRISQIGYSPNSTVIFIGGVPNKTILPSAVPELGIPFRGAIQRLTINGHRFSELFKEFQR
TGRIMQYDDVPCSNVKSGNRNCLRNLNKYGCRCLNEYQPPEYIQQDEKAGADPNDSLLLD
GRNEYALVKKMISKRRSKILTDYQFMIKTNKSEGLIWWESKRHMIRSNYIAIFVLAGRLG
FAINLGSSPKVKGEAKVVANCGQ
Download sequence
Identical sequences Bm1_43320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]