SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_43325 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_43325
Domain Number 1 Region: 115-188
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000749
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 2 Region: 59-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  Bm1_43325
Domain Number - Region: 28-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_43325
Sequence length 268
Comment | Brugia malayi Kazal-type serine protease inhibitor domain
Sequence
containingproteinXXXXaaXMQLQPRVSGKKCDHCASGFWGLHLIAKGALGCQPCG
CSVFGSSRFDCEQSSGRCQCKSDSYGIKCDACDPDSILTSSGCLKKTEFHAPKDCSELRC
HHGAVCVITSSGMPICKCSKQCSLDHLGIIAEMTICGSDGNTYDNICELQQFACLHQLDL
VPSTLGICSQDGNNEMQRRRERKLDTTPILGNLCVDDTDCHVFNTYCGQVNFLELKNCKC
KEGFFPSKDMTQCIQGKRAFFTLLPDIN
Download sequence
Identical sequences Bm1_43325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]