SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_43875 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_43875
Domain Number 1 Region: 267-479
Classification Level Classification E-value
Superfamily Caspase-like 1.09e-36
Family Caspase catalytic domain 0.0049
Further Details:      
 
Domain Number 2 Region: 54-135
Classification Level Classification E-value
Superfamily DEATH domain 0.00000106
Family DEATH domain, DD 0.014
Further Details:      
 
Weak hits

Sequence:  Bm1_43875
Domain Number - Region: 177-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00393
Family C2 set domains 0.041
Further Details:      
 
Domain Number - Region: 449-542
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 0.0484
Family Sporulation response regulatory protein Spo0B 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_43875
Sequence length 646
Comment | Brugia malayi mucosa associated lymphoid tissue lymphoma
Sequence
translocationproteinXXisoformbXputativeXXXXaaXMSSVASLQEYDLST
NLAELPIGLHWRLASSLNFQTVWMKVIGDSTSSPFSLSVSEYDRILRSENQGSSLLYLWG
NRGQNVRHLLLRLQSFSKMHGTSLDGPQLALRRKFVPVKWSADEQITVKVIGADNCMLQL
FCHARGFPWPHFQWMENDKDIDCSNGKALIISRCRIWNEIEEGFEYSTFYRRPGKSFHSK
LITKPVDLSLFITANVTGGWNAELIATDKVALIIGNCNYINLPSLVTPHCDAEMFAESLQ
NLGFKTVALGDLNLAEMHFFIKEYRKLLGDGVYAVFYFVGHGFEKNGKNYLLAVDAPSVD
CKMTECISVEWVLSVFEDSHPALNLILLDVCRKNVKCVGCLDDADNEQIPKIARNTVCGY
ATSSGVSAFEVHGERNGVFMKHLLQHIADEATVLEMLTKTFQEISNDTRICDVQIPELKS
NLVLPRGLRDPLICYGHTASFNCHTLYWRYMHELPSPINVQFTDQNMFVIIWYDYVGHFT
NKVYIFTSVNDLSDKNSAGGLKPLPTKFSHVAHLHFPKHVDVSAERIIEDGNDGVSISVM
LSNLQRLKGTVLFSVDLASRKDDVVIASKSNLSLGDVLVTRIYRVE
Download sequence
Identical sequences Bm1_43875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]