SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_43985 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_43985
Domain Number 1 Region: 70-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000249
Family I set domains 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_43985
Sequence length 199
Comment | Brugia malayi Immunoglobulin domain containing protein (200 aa)
Sequence
MGKYTTYRYSTTALMCEPVFTGTNSQAQWYHNGIIVANVSRIDNREEGEIARIIVAFVEP
FPSNSRPTFRPTLAHFGQHVTADCPKTKAVPPPTYTWFLNGXVVDLSNKRIVQNSNGSLQ
IQRFLSQDIGVYECVVRNFAGRTSAKTYMDAIPFISNDIFDGTIFTSVCQSISRRGLPWF
LISCLAIRFDSFTSICVML
Download sequence
Identical sequences Bm1_43985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]