SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_44870 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_44870
Domain Number 1 Region: 520-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.028
Further Details:      
 
Domain Number 2 Region: 29-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  Bm1_44870
Domain Number - Region: 379-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000199
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 576-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000367
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 169-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 149-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 213-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0233
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 315-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0594
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_44870
Sequence length 705
Comment | Brugia malayi EGF-like domain containing protein (706 aa)
Sequence
MRRFHTLPKIPYIPDAKYRRQQTGDLETNFDPCKITQLCQNGGTCVSKKGAYYCQCLPTY
YGKTCEFLANQTSCKENLCQNDATCYSIQQKRQIVTTMEKNEDMQNFTDTKVIQWVRYEY
VYYMYFRPRESCCFLLNEFHESPRINLSILRCWCRQGFTGSLCEYSEELRECEQDYCLHK
GVGKLMNSTDGTAECDCQCQEHHTGKRCEIVLPCKDYSCFNGGVCMNEPVMNNTDGELTY
KARCNCPPRNIYGVAINFEGEQCERLTVVDNERIHDECFPCRKNAKNYAIDCLDKYTQNT
TLGYMEEILKACGKPCESAARFCLNGGLCNAEGRLDDDNRTSYIIPVCQCVGLDEGILCE
RHVNSPCDATTYDPRTPEEKCGEHGTCVGKTMHDYVCDCYGGWTGEKCDIEEPCYNNACS
PGSLCVSVPIEQREKYSLGYTCLCAINQDPDFTGSNNTVKCIKTDFGICTNHVCKNDGLC
YSCETSDLNNLQLCSDEEKRRGFRCLCPHGLLSPFCEKEADACDRNKCQNGAECTVDPEN
EFNYICRCRLGFSGTFCEQKLSPCIMQGEIMNQEKPTSCGLQICMMGTCTPDSNFVRGFR
CDCVDGYEGVNCDSLKRTDIAGFIRRNYWWTYPSIVGLILTPMVAILIILSENRAKREYE
YKLAEKRYLEEAKQRQKKINEEKCSDFGTAGTQMSTTQKYNSTEI
Download sequence
Identical sequences XP_001900437.1.25112 Bm1_44870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]