SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_45355 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_45355
Domain Number 1 Region: 283-422
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.05e-57
Family P-domain of calnexin/calreticulin 0.000000766
Further Details:      
 
Domain Number 2 Region: 93-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-57
Family Calnexin/calreticulin 0.0000019
Further Details:      
 
Weak hits

Sequence:  Bm1_45355
Domain Number - Region: 402-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0791
Family Calnexin/calreticulin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_45355
Sequence length 615
Comment | Brugia malayi Calreticulin family protein (616 aa)
Sequence
MPVKSCNFFQFSYLEVRWNMRQHLWLCFVLAGLLLAACAAHDEDDSNNDLGGKNVIDEEE
KSAKLDYIPPPFQTPMVSGSPLLVDWFSNRNAIGRKWFISKGKKDNVEDSIAKFNGQWEI
GTPSTVVIDNDFGLIVKSRARHHAIASKFSRPFKFDGKPLIVQYEVKYEEGQECGGGYLK
LLTEGIEALEEFTDKTPYTIMFGPDKCGAKSSILFIVRFRNPKNGTVSEHHAKQPSKPVS
TYFDDHKTHLYTLIVRPDETFTVLVDESKLISGSLITDLEPSITPPTVIDDPTDKKPETW
DEREKIDDPDAKKPDDWDENAPRKIEDVNAVMPDDWLEEEEALIPDPEATKPSDWDDSMD
GEWEAPRVDNPKCKDRSGCGKWTKPMVDNPNYKGKWKPPRITNPNYKGKWKPKQIENPNY
FEPHPYSQLQPIIALGIELWTMSTNIIFDNIYVGDDENAASNFAKQTFKIKLAQETAYEN
ASSPSQGIFSKLVSATEERPWLWVIYVLFILIPVVIIAVIYFGRKSRAVTLDYKKTDESH
PDDEVPDLVGDDDESMERSSQEPEAHDDNTKEKKRTLSRSPNRVYVEEEASSSEEFKNEG
HNSPKMRRVRQRKQD
Download sequence
Identical sequences Bm1_45355 XP_001900533.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]