SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_45425 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_45425
Domain Number 1 Region: 1628-1750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000102
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 1882-2009
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 1796-1845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000294
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 1829-1870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 2609-2654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  Bm1_45425
Domain Number - Region: 2407-2534
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 2074-2106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00608
Family EGF-like domain of nidogen-1 0.039
Further Details:      
 
Domain Number - Region: 2376-2411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0294
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_45425
Sequence length 3032
Comment | Brugia malayi Calcium binding EGF domain containing protein (3033 aa)
Sequence
MLHTYLIKGIRRTFSTDSIQQKTTGGFLTIDKQVISSKQFGLACYFGCPADSHCVNGTCH
CNDGFIGNTFEGCADINECELGLCNQSDSWCVNLRGSFACCTTNSTLSDCIGLEITDGRE
NDISADNTKEENFALPSAIGKIAGNMKVGTSGSGSASDTGNTNESWSGSSSNGELSDNRR
KTSWAIETVGEWRNFTGHAIIIGRGRIESKKWNVAKNKNGTQIGIEVHKNGTEEGKYFQF
SIKEEANKAGERSKGTEGSGEDIEISDGVEKLPHDETLTSLSSEANKSSQKGSDEILTST
TASSIPTIRNFSEVLKTREEETKKPEIVILRYSKAPINNYTSTQSKISFEGNPESSALLT
STLKFPKILASEARGKVLSEVNTTTYNSGKSTTSTVSEIIKYSTDAESISEVGPMKSEEL
ETTTILEISKTAKTVLVTESSLXKSKESLARTGNDKRKQIAKATNKETALTIPSNVNDEL
RSSAYITSEDLEMQMGLTGKEIDDSLTSQNQAIVIGAVTFPSIPESKSQWKKEGELKLQP
ENFTMTISGADIAITVEQETVSPTVIEVIHKGAVTVIPESNSSGSSAVAHSESERPAKLH
ETSNPFEERLDKTTLKLGLEITKALLTTEQTGIEIVKASSDHIETAETGVTLHPYPKSTE
PVQFIENTIELKSNSTSVSQKTESKKPQNSVPIGTTQGQAEAINFKKLPEQFTEIVENTK
VPVIFKQTTKNVEVDDMISRNVVTAAGSTSNLSSFNQLSTMAFNTASVSLIKPISYNNLP
ETVSTQYSVTTIHVTPTESGVGTTQESSTAGTIRLSASLPSQTTTANLSSRDAAEEVKAI
RNDKKHGKSATTETENGETSSKGIELXGSGEEIIEVQTVNSTNSFVSNSATETNNLLRTA
AIDVRGHEVGLEIVLINGHPKTTELTSDETMRKSSIFGSHRIEESTAFGTISSQDFEKSN
GIIGVNTIRNMETTFETTAHKKQGSFEEREIVTSTEISPATNIDGSEIVLTSALGATELA
KISKSSTFLRTSETSLPIDMGDSIKNTLKPASSNGATVLHVDHGKLGAITTPKFIASSSF
STRKTLAKVSEKEERINSTVENIIKIKAITEGAENDVVTSDGKIKYSSHSTAKDLNMRFG
SVTAVETSTFKSTAGLVSTSKTVPGGIHPDITTSGNPFFEITEVSRIADVTEAFSEPNKW
VASNAGQFTATLSKFTANKTERKRLKDVDRSKSVSEMSSLTSPVMEIGGIRTSTIPEITR
LETSLISELKFIKETEQEINITTDTTRETSSPKVSLQSKKTEELVIPLLSSNFMTTVERK
TSGIELDKTTAVLELDRITELSASETGTTKRITEDETLESVMSTKSEMEFTKRMSTLEFP
PIDSIEREPTSIQETAFSVSGTDIHTAAFLAFKTSTSPSFPSPETVTNDGSIITVANSGN
FPSTLAEEVISKQFLKSVSQVSPLITTSTLSVGNTVVFQPSESSKTDLSLTPTSSRGNLE
TTLIDSMNILKIEPETVGWTIKPEETGKNGIALEMKTAVPAVISKTKISESTHYPSGISI
KVEQTPTKSSVSDEDLFKITQQETVSPLYANISESEEYVTATKTVYTIQETTGTPITQND
IPAASLRCQSSNECGADAYCERRSGVCRCYSGFDGQPPMTPCVDINECERHLDDCDLTSR
CSNIVGGFMCFCETGYRMSKEHICVDIDECQERAGRPCSQHAICINIPGSYQCQCNLGYT
GDGYTCIPTDKRHCKEEELAKSNCGTNHLCLVNVKGEIDCETCKKGFVKEETDCTDINEC
AQSGICHENAFCENIDGSYSCHCQSGYKGDGYKCDDIDECQNNPCHPQSICTNLPGSFSC
KCPDGWIGDGKNECINPFDTACLDKLSVCNQVNHTSCLSVTLGVITTSICECSANYRYNR
IKHICEDIDECVENRHSCDPSNSICVNTLGGYTCMCSLGYEGVGGVCVDVNECERGVADC
NVPYRCENHLGSVGCKCPPGFIGNGINCIEIKSFTKADSDCNDEWKKTCQHMNRTCHIDD
EDVQQCGSCIIGYQPLNGRCLPVQETGNCGDPQKNDCDANAECIDVHPGHHFCTCKVGYI
GDGRHCDGPNCHLNVTMCHKNARCQLDGTCKCKNGYQGNGVDLCQLESEKKQVGKTFKNG
TGVLTITKATVNREIKQDNETPSLNSVSDSGFGTLFTVMSSTKVTPTTNDRRSQQNNGME
EVTSKSTGPTEGSLEKGNITVVTTSTTSPGWVTAASHVVSTISGEGSIISEDWQHSTKSS
NKLFTAGALPSEMASSRQGAKESAHVVGSGAWVHSGLTSSKGAIIPEEIQKTAVQKCTVA
NQSTCHEFAVCAEGECVCKLGYHGDGYSICMKDIGDCTFDPTICDLRAVCDKSTHTCKCI
QGYIGDGVICAPDTFDCLLRPNLCSNFAECIGRRCICTAGYTGDGTECVTVEPVQDCTRC
DAKAKCYNGTCICNKGYFGNGAVCIADPTDCVHYPGLCHSNAICDQEKRRCKCTRGYIGN
GIECNRKKDLLCLNDRSICDHNAECLLTGICQCKQGFEGDGYYCREVNVKFEVIQTNVSN
VSECEQQCIANEECYHGQCRCSEGYKRGPNTTCMDIDECSMGSHNCHPVALCTNVPGSFT
CICPTGYRGNGRKCSQHHPLHNMSVDCELDGMTLALVNDPDLYDGRIFVRGQTDNPFCSK
KLNALLANETEYHLIIQYSHCNVRFEEPNTIAVTVVIQRHPMFITERADAYDVRCTYPVG
VRKVASHVGISEITTTKTIVETGIGPTCSLTVTNEQDQLIDTAIVGQPLKLALTVYPNDT
YAVLPRNCFAINLETGELYLLTDQSGCAIDTELFPEWTYRQVWLTTAKFRTFKWPDSSMI
RFQCDCSACIESCPKVNCTKRRESTKQRRFRHVREVPRNSVDEELEKHVVKSAKWMAYSR
ALYINEEEELVRAQRDMKRWKYQGLKTYEEPMNALPDDICIRALWVILSLLPLILLLVLI
GLLSAMWRKQLSTKIRWRRAVVNDSESSYLKF
Download sequence
Identical sequences Bm1_45425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]