SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_45475 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_45475
Domain Number 1 Region: 1517-1561,1589-1742
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-31
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 5212-5400
Classification Level Classification E-value
Superfamily vWA-like 1.67e-31
Family Integrin A (or I) domain 0.0027
Further Details:      
 
Domain Number 3 Region: 933-1134
Classification Level Classification E-value
Superfamily Fibronectin type III 5.91e-26
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 4 Region: 5422-5606
Classification Level Classification E-value
Superfamily vWA-like 3.34e-25
Family Integrin A (or I) domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1225-1431
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-22
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 6 Region: 333-433
Classification Level Classification E-value
Superfamily Fibronectin type III 1.54e-18
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 706-820
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-16
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 8 Region: 518-619
Classification Level Classification E-value
Superfamily Fibronectin type III 6.68e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 4727-4830
Classification Level Classification E-value
Superfamily vWA-like 0.000000000175
Family Integrin A (or I) domain 0.039
Further Details:      
 
Domain Number 10 Region: 245-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000245
Family I set domains 0.018
Further Details:      
 
Domain Number 11 Region: 4175-4330
Classification Level Classification E-value
Superfamily vWA-like 0.000000000394
Family Integrin A (or I) domain 0.0051
Further Details:      
 
Domain Number 12 Region: 6046-6090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 13 Region: 636-727
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000193
Family I set domains 0.027
Further Details:      
 
Domain Number 14 Region: 1969-2037
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000001
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 15 Region: 441-544
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000104
Family I set domains 0.022
Further Details:      
 
Domain Number 16 Region: 168-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000998
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 1762-1839
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000128
Family I set domains 0.018
Further Details:      
 
Domain Number 18 Region: 1138-1222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000383
Family I set domains 0.012
Further Details:      
 
Domain Number 19 Region: 5685-5837
Classification Level Classification E-value
Superfamily vWA-like 0.000076
Family Integrin A (or I) domain 0.053
Further Details:      
 
Weak hits

Sequence:  Bm1_45475
Domain Number - Region: 1435-1513
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000233
Family I set domains 0.053
Further Details:      
 
Domain Number - Region: 5875-5943
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00436
Family Fibronectin type III 0.006
Further Details:      
 
Domain Number - Region: 131-163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0121
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number - Region: 828-935
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0485
Family I set domains 0.039
Further Details:      
 
Domain Number - Region: 3156-3339
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0523
Family Serum paraoxonase/arylesterase 1, PON1 0.066
Further Details:      
 
Domain Number - Region: 2949-3128
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0719
Family Serum paraoxonase/arylesterase 1, PON1 0.066
Further Details:      
 
Domain Number - Region: 2040-2082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0754
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_45475
Sequence length 6163
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (6164 aa)
Sequence
MRTPSDYQQSSVVLSTNDTGRCVVSADKASHYCGDIEVTAPPFPPPEAGQCHFSSESSRE
ICWPRYEDLDTTCTDIGNGMVSAPAVKHAAIRAMAFVPPDNLRRLVRQYYRQKGLSVPRN
TTFSKNSFLFALYECDDGYEFVDEVNSMFCINRHWVITPPKCRGKGMCEIDNGGCSHSCL
SIEDRIECRCPHGLVLGSDQKTCIKPIPKNLCRILNSCSCTAINENQYSCTCPKGEKCLL
LRGRPKIYIEPAAPYEITPGGNLNITCSAVSHPFPQIFWQRGDEAVDIAPVKPGTVRSEQ
ILIIKELYKNTQFTCHANNSLGKTERTIEIVVTGPGSAPIIRGIDAGRSSVYVRWDPPVI
VNRPVTSYTVYYTNNGNQPIKNWKKVNVEEPDREVTIKDLRPNTQYFIRLRANDKLGPGR
LSNPVSLNTRRPAVRPQLFIQEGDTIYVGPLKRFSISCNVTRGDPSPKIAWYTRARPINK
SQRKKFITMEHGGLYESTNFSCVAENDAGRTTKRIQVIVTGPTSPERIRYQIHGNNVDLQ
WEPPRITNGQLKDYDVLYTDNPKLSDEYWEVVKTGNPDARSLRISNLKEKRDYTFKIRAH
NELGPGLFSNQFTLTTWLAARPPIVTITPAEKVVKDPSNEELIFECEAIGVPRPKILWLW
SGGLVEDGKNEFRIYDVTPPDAQNRSNSKLIAEKTNRAGVATCQAVNPHGSDEKHTEVKI
VGPGSPPRDISTIPFTNDFKVSWNPPKYPNGKIIRYIIYYTKNPDDLLGDWEKTAVGGDQ
LEVTVSADEDTPYNVRVQAVTKDGPGIISEAYDVTTGKKPVPLSVKLVILDPQVEDGSTE
TVVEPLKTIIFKCDAKGRPAPQISYTWLPFNETESGQEPISIPAYSDPQEAHRYHSLDVN
TNTATKRALMCNARNIDGSESDQHIFNVLKPGSPPENIQAIIDLDNRVTMSWQEPKYPNG
PIVKYKVYLTSDPSEPINHWNIYDVEPSEEPRLVLERGKLQPETPYYIKVVAVGEKGEGL
QSDIILFETVSGAPIDEPKNVLATVERDNTMDISWTGPSAYTVYFTPLDQYQTSDDAYKQ
WDKIVVQSSENFGTLRLNKDIYDILPNKLYRIRVSATNDLSEGPASEPITIRTESGETPP
VIHLEPIDNPLTVAPYGSISVRCTATGIPPPIIMWIIGTNASDVIRGPILQLTNLRKDET
VTCKAENNAGQAQEVLQILVAGPGTPPNEIVAFPLENQQASIEWTTPDSPNGRITDYIIH
YGEVFDGEALPRAWETVHVSAEEPQKHRLVGLKPKTSYAIRLQAMSDRGPGVLSDPIKIT
TLPLAPAIVQLSDIKVHENNTVAIQFDAPRDPEDPGKPIKEFLIHYTDDDPLSEDAEWKE
MFWTEPDDDFSVSIPIGGEHFKPDTKYSIKLIARGEIDSPPSEPIVFQTGDGIVPPEKPQ
INVDAPDDVIRVPAGSDYTVGCSSTGFPIPRIFWPLSDGPMLRLQDVKETVKAKCVAENE
GGRTETPFEIFVTGPGNAPSNIRLNSVRPRTIHIDWDPPTIPNGNITRYIIYYTPLDDQN
IVYQMGQIPKKPITEWMTSHKDSEPLIGASQRADLIDFVEPDTAYAVVLQAVNQDGPGPY
SEQHTIRTMSRAREGPPLDLKVEPEGQRSANVEWHRPITSEQLPIGYELYYIKADAKIWE
DDLASIDDWSMISITEKDEDRLYYKIDGSLEPDTEYVFRMRAVYPDGPGVFSDACITKTL
PDGNAPYILISNGEHGVEGKTEITILPGSALDLSCNATGQPRPAVKWIRSGYYPIDPAWV
KADEKYAIWFLKVSNITEDTSFNCVAQSPLGFANWTISVRLLSDLRPTWKNDFLVAKNED
GEVAVHFTDDLPDYLKGSQNPWNIYWTDNPSKPFETWNLIPSNGRPLDRIAIPEMEPGAK
YHLVIEQPSAGIKTPVFDIMTPKAASDIRVGTDINGETVLDFKPALATEPIKKYIIKYWP
DSNPSAVMYMETPVNVTDKIVLDGLQPEIDYNFMVTAKFDDGDNLASEPTKIRTPSEDIQ
CHCAHACMFEEDEEGMIIASCYCHNGFKLADDKKSCEPIEEDEEGSIVQVTPPTLIPESE
HPKELTTMPTLFNDLLSKSEKFDKEMEILEPKELAKIKPSQTDEFGRAIWQDEQLVTTSR
ESVSDGFSLISTDSSQQDRVLSPVVGFDGAPLPTDEYGRAVDNLRNPIIWDNEGRPIGPN
GIPLRRNYKGEYIYPVIGKNGQPLPTDINMKPIYPIVGPDNQPFRKNQEGMHIDQYGQII
PTDTSGRPISVDGSPYPTDEYGRYIVDSENVIQQVVPTDELGRVIYPVFYPDGILLATVD
DGRFVNEHGHLIPTNDAGLPVNERDEVLPKDSEGNFVYVGNYILPTDSNGQPVKVQYNGR
FLKSDKMGHIIGPNGQLVVVNDYGYPIDESNTVFSTTSDGIFVLPVTDGKGMVVPGTEQK
KGVKRLLNIVGPNGHLLPTMEDGTVLDPFGKTIPTNNIGEPVNYRNEPLPTNSEGQAIYP
KDGLDCPLPPTDRHGRPVYSVVGPDGRLLPRKYDGAAIDPDGNLLPTNAAGVPVDRKGRP
LPSDRNGSIIYPARGISIEPLPTDSNGKPVYPVIGLDGRLLPTNKDARVIDEDGRPLPTN
AAGVPVNEQGEPLPFDQNGYIRYPAVERQGKSAYIIIGTDGEPLPRNGDGLVIGPDNKPV
PTDASGYPVDHRGRPLPQDRSGNIIYPANGIDAEPMPTDRNGRPMYLVIGPDGQLLPKDS
NDVVIDIDGRPIPTNAAGVPLDHYGKPLSVDRNGYVFYPKESYESVRADVPVYAILGPDG
VLLKQNADGAIVDPYGRPIPTDSNGYPIDNYGKPLLRDNMGNFIYPAGDLNVGSAPTDAS
KRPQYFVIGPNGEVLPRGYSGEILDPYGTPIPTNAIGIPVNNQGEPLPRDIQGNFIYPAT
GLDVKLLPTDRSGKIVYPIVDSHGEPLPTNENGALVDNDGSPIPTNRFGLPVDEHGNFLP
KDIKGNFIFGTPIKPTDHSGLPVYPVIGPDGKLLPQDKDGNVVDPAGRPIPTNDDGVPVD
NKGQPLPSDKTGVVIFPANGLDAEPMPTDKSGKPVYSVIGPDGHPLPITADHKIIGPDGN
IVPVNAAGVPTNHRGEPLPRDRXGNFIYPATGLDVKLLPTDRSGKIVYPIVDSHGEPLPT
NENGALVDNDGSPIPTNRFGLPVDEHGNFLPKDIKGNFIFGTPIKPTDHSGLPVYPVIGP
DGKLLPQDKDGNVVDPAGRPIPTNDDGVPVDNKGQPLPSDKTGVVIFPANGLDAEPMPTD
KSGKPVYSVIGPDGHPLPITADHKIIGPDGNIVPVNAAGVPTNHRGEPLPRDXXGNFIYP
ATGLDVKLLPTDRSGKIVYPIVDSHGEPLPTNENGAFVNNDGSPIPTNRFGLPVDEHGKS
LPKDVXGNFIFGTPIEPTDHRGLLYPIIGPSGELLPTEESGNVIGPDGHAISVDNEGRPI
NNRGETLPSDRFGNFIYPLGGLDAELLPTDSNGLPIYRVIDSDGQMLPTNDRGLSINGQG
KSXPTNAAGVPVDDHGKPLPIDSNGNLIYRKDAQKSLSTDQGIYPVIGPDEELLPADKIG
VVDGQPSPADESPVPVYPVIGPNGELLPTAEGGLVIGLDGSPLSTNAAGKPVGPDASLLP
TDEVGRVIHLPPEEPLSTFATNEYGHIVHPVVDMAGKPLDKDDTGAHITKNGIPVELNEN
YLPVDPDGNILPTDSQGNYIFPDLDIMGRILPTDKTSQTLYPLTGRNGQLLDTDSNGATS
RPDGELGKPVRPDGKPLPTDEEGLFIHTEVIGTHPTKKVVNIEGRPLPTDELGRYLLAPN
FPVRQDDSGRLIGPDGQPLPTDDSGNYVYREKMKYPSDAEDDFGHPLPTNEDGFYVRRND
SMITTESVGLMMDGQGVILPTDERGILIVPELPTQTKSYQVLDEQNQILPTDEAGNFLYH
NGYPIAENEEGKPISPDGIVLPTTDTGYYVFATTRQKPMIPSQKGTDHYPLPTDQFGMSM
MTSSSVQGIYGMDGELLPIDRQLINEEGEEARLGEKVRFSEPAEGILSTDEYGKYIYPAL
KPXGKLYPTDRGYRPVYPVIGYDGELLPTNDEGLALNFEGHPIPTNNIGRPLDEDGIMLP
MDSKGNVVYDTGKKNCDTHRGIMDITVVINVEILDRDSFDHVKKVIQNLVIEHFDLSPDV
TQFALVKYAGTAEVPITLGGYNEKMELLEELSRVKIDHIKEHPRLIVGVSAAKQQFVSFG
REDAGKLMIVITNGQDIYSEDRFKDNIIPMLVVGSKEFEEEIKDWTKSYILVDSWKQLHA
DSIANMIEKECLLGRIFIPTKKVSSRSKSERFEDFTGSSLTTDEFGRIVVLPTSERVILS
TDEYGHVAYSVKDTSGRLLPINGNGLVMDRELVESDYSKXIASNRRQLPTDESEAFIYSA
GGKDKALSPDSKKGWNTSIDEKPLSTNQDGLSLDINGQSIVTNLAGKYSSQGSPYSFNGN
DNIIMSKRTEKITDATDYPVIDPDNILLSRDPSDFYINNIERVVERDDSGKLLGSVEKMM
PSDAGGFTYRKHSQGGKLPRSDSNISTAKNDGFIVDTSFHKRLPYTLSNNKVSDEHNQVS
FEEPEAIAETRNFINNQNSPLPIEVDQAGKPVVKVEPFPTNKYGDSIYAGGSMVSTSASE
QAIGPDDSLMSVDYRGRDVSDYIPDRTGLGETKLLAKVSTCNKVEKSVNIIFMVESSNAT
GTNLNKIKFSLLNFIKKNINWNIAKVGIVSYGSTMNVNLNVGNYQSYDDLKKSILSLSLI
GGSSSGDEHAFRTALQLFREKYNNDSGELIMHVFKTPLSKDAQIIADHLKMNETISILSL
GSDQWYRLENDKEIKKLRSNMCLLLMKSHLARTRKPSDSDGGTVRSDRFGRPLDTYALSL
PTDEREGVKVLPTNERGQYAKQITVNEDKTIAPDGKIISADGGKQHIYQTFASENRHRST
NSHRKLIYQIFGDDRRILPTDQTGARFKVDGKSGVTNFYGEPLNSERSSIFSTDTSEGYH
ISTKKLTENKRNSSLLYPATDSNLKTIADTFVSATSVSLPFLILFPDGRALSIGENGAYL
DDNGQSLVHIDQSGHPIISANGTPLQKIGNGKYLYPYESQKEKPTFANVGDEDHLLRTDS
GGRQIQLNDRERSGYGRSSPEDERGSYVETTLAYHASTSSGIDTWTSSSSYCVVSSNVDM
LLILDSSSSVRVVDYRIMKDFIKKFLTNHFNLQRNYVRVGVMKYGDKVEIPISLGDYDSQ
TELLSRISETRRMRGNANLGQALLDASGEFLIFGSKDIPRIIIIFSNGRSRGELKENALL
LRNDTKVHIFLVDVGNQGDKAQNLAIVGESNPHRIIAIDGWHAMRPDILNPFVNELCKLL
PQKQDKASRDSTWPTRQTEMRIATPIRICNRVDFQADIIFVLDSSDNVTSKEYVNLKEDI
SMLIDDIFDLSPDIVRIGFIEYSDKASVPVPLGYYDNKVQLLADISNSEQLGGTPVIVRG
LHAAKEQFKRHGRNGVSRILLLVTSGANRGNVATAADDLRKRLKVSVFALVVNTSRGAQM
MLNRLTGDEHTQRRVISISSASKLQERELLHIGQVLCGDSDVIPATIWPAQETPHRTTKR
DVSYGDSKRKKDKISRSSLLYWKTTTATEHVAPKPLXKDGLLRPYQISIVVDNTARSPEK
DFRLVLNHIVSFLKMRFSPESKLVQLNLVGVGSDGTNLKAADFGVDQFYSLINLIHTKHC
RSDEISPKLGRGLDEAMLLAKEHAVKGVIQIILIISADGTSSDDAIQSAQNAREQYVDGI
VAISIRAPSSELLKELSLGSSTNYVSTSITRKIKLTRMTRPPIRKTSKISMNDATNVEVT
PLSPNSLLVSWTCCTNNKADYIISYTSDLSLPKEYWHKLNATCRDSFGRKIDGLPSGTYS
VCVETLQRYINKSVPFNTDECETIKIDSDTTAPPDQKLPNSQSTVQCQCICANNGKAFVK
PTCGTLMDPFRPVATLPPAIDGECHCSIPSKGGRCPSGYFFDRGQCYDVDECEQQNGGCS
HGCVNTPGDFYCACPHGMMRDPADLKMCISVASSFDRIAALFGQYLHANQYNANATSNEK
SDAQTDGKVVRYKATVKSEDDKTISFEWSLMPAVVRKAFKWLF
Download sequence
Identical sequences Bm1_45475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]