SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_45650 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_45650
Domain Number 1 Region: 910-1166
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.53e-16
Family SGL-like 0.063
Further Details:      
 
Weak hits

Sequence:  Bm1_45650
Domain Number - Region: 226-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000687
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 323-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 439-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00202
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 256-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 586-667
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00589
Family Carboxypeptidase regulatory domain 0.039
Further Details:      
 
Domain Number - Region: 291-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0154
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 371-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0161
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 465-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0239
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1087-1167,1245-1337
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0262
Family Tricorn protease N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_45650
Sequence length 2429
Comment | Brugia malayi EGF-like domain containing protein (2430 aa)
Sequence
MSQDKCHPTAMDKKRLKPFCNWRTLAILLLLSLAFTCFTILLLLLGNDNSRYVCEQSTKS
VYSSASTGLFPSGTWHNVHIKATVLKPLPESFELGQQIEADLPPGVIVYSYFAVQKNSRI
IFNISVNSQAQLVIYGRRTALPSPATHDFMDIVHADWLTISGNSSDTRLKRFTPLLRTAI
LTHYLLSGRWHIGLLNDILQPFPIRLVAAVIADQVADERTDDCRYDCTGHGQCKGGKCYC
FPGYSGTYCEENSCPVLCSGNGIFSGGQCICHEGYKGPDCDLLAHWXEAPNCNGHGQCNQ
FGDCECDIGWKGTFCDKKDCKDSQCSGHGVCYNEKCYCEDGYRGEQCGEMYLAESCIGKE
LQLRDSEPESDADSACTNRGRVDSESGLCICIPGYHGSKCELERCEVECMNGKCGNGVCV
CDEGWTGMDCTELKCLPGCEQHGHCNNGTCMCSKGWNGENCYIAGCINDCNGHGVCRLFS
GQWKCACHTSYFGENCSLPVESSCSDGVDNDNDGLIDCEDSECCMDSSCSSSQMCVTVIQ
PRDVLLKVIPSINGNFYQQIKFLIQRDSVQRYADERYFNESFVSVIRGRVLTEDGSPLTG
VRIAEARHPTLTGFTLSRSEDNGGAFDLVVNGGKTITLQFMXKPFEKLEKSFYIPWNEIV
YVGDITMRLGTAAVIVNERLGISEKCRHYHAINRLAPVIFASWHTNQYSGKLTSSSYSVQ
LLADSGKSFDSIQIPTTNEVYLVYDSSFADGYHSTLLIELLPSRIPEEIRLVHLSVNVAG
NHFHTVFSAMPNLTYTYSWEQTNVYTQTVNGLVNAKVSVGYEYEGCSRSIAWIHRLVKLE
GHRANRFMLGGWSLSIHHHYDIIHNVLEKGDGVKVFLDEAAPLLITVVGNDQQRPVNCPF
CDALANDARLFRPDALCVGSDGSLYIGDYNLIRRLTPSGMLISLLELSISDTAHPYYLAI
DPLTDSLFISLPIHAQIWQVNKDIDSTTDLTTNYDVVVGDGSICPSSSERCGDGGAADLS
QLTFPKGIAFDEYGNLYIADSRRIRIVDRERLINTLIEERENGPRPCIVDYTNLSDIITV
WPTSLAVDMLNNRLYILDTNVIYRISLDTGMGTLIAGTLTECEQMKTLAGDLLPQRPLTE
ARSIAVAPDSTIYIVETNNKKINQIRAIYPDNRSKVVAGKLSKCDCDRTNCPCXDLHSTV
ATSAFLHSPSAVAVDSNGMGNFKIKKLQKPTAMYDEITRQYRIHSPHTKEIYIFNKAGLH
MSTVNLLTGDTIFTFTYDVDTRLGRLSQITGTGGHILRVHQTDDGKTLLETATGLETVLN
FDQFDGTLSMITFPSGESTKFSYFPGHLLRCREILNRNWCFEYDEFGRAKALLNPAGIYY
SVVRRDVIYSNLVTTVARNNEPYTVYKFSNRKFTEEGTQDQQVTVLDEGLSIVAFGARTH
FDGVTHPLLEPHETVILKRKITLPEATDPPRRELNLRFEWRGYIRRKESGRRDPEKWRRV
QQVGKRPRINGRNVFTIEYDCDNRQDTVRNSLDEEVLTVQYNDAGQITSFIPLTPREQPH
IDAMKIMHDSLGRPSQIAWGALTIVFEYDRLNRIILISAMTGGASYLERKFFYQKENQLI
PSIVQMPSGEKYRWRTDRVGGITFLKTPAGIVHHFMQYAVFDRVCRQRTVLFSNASYVAC
LSDDGWLLDYRTPDLLHSLTVTRDIYGRVIQITSDAENTFFKYGGPNGNLQEVSNSFLKR
TYKWQGVIQSIVREAHMVVTHSNRRFGESFVEFLYEYDDFFRLXTITIIYNAMRLQPQKY
QYDSRQGRLTKLNNFVFLYDLCTRRIMGETLVMEISCNSANEEIMRTLIINELKVVEMRV
TRHSLGWVEAVDWTIIGEKRPTEKRTFNTDGQLVQYTIGEADDLRWTLHYDLDGRLKAIN
DAKILFSNGKLKNVDQVDYTVNANGWTRSRGKVYFEYDVYGRVHRIYQRGLMDVEYGYDD
RSRIIWRRVGDEQFQRFFYAIPDRPYLLTHFVSTNETPSTILYDDRDVPFAFYHGDKYHA
LFVDIDGSVRFIFASDGTMVKEIIRNPLGATIVDSNDSFYFPLGYRHQFDDPLTGIVILG
PEARPYDTFVGRFMSISISYVTSPVDIFAPEYESDPFRAIPTESNLLRHFPVDLEKWMEM
CGFSLSQALPSTPNPIQNDGLKKLLQLPDSLCTITATHVLSSSFCSLIHKVKHFKQFLTA
TPPVLLPFSHPPLFVLFDKPSYSSSDSLGFRGLTFIKRPSDKFEVIGHSLKEDEKLNALR
ILLVGSSFLNIMNMHLSGELVQIHFTTNLTSDKIPLEELARFFNISNFNQQLTLYAGNTQ
LIFHYSNDSEAVRSELIREQTLEIGKIIWNDEVERARYGTITRHSWTESELSQLHSKGLV
SGYEPKFRPGKSVPVLWNTYLWTFQRVAA
Download sequence
Identical sequences Bm1_45650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]