SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_46560 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_46560
Domain Number 1 Region: 14-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.84e-54
Family Ankyrin repeat 0.00000661
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_46560
Sequence length 242
Comment | Brugia malayi Ankyrin repeat (243 aa)
Sequence
MYEKHTKTLEAARTELVESLRKNKAEDAKRLLQKYDTLRSGKDDSGRIAVHWAASGGCLE
IVQFCISQQKDDAIALDDMGWTPLMIACSAGRLEVVRYLVTLPLVDVNTPNNNKQTALHY
AASKNRPQITTILLKNGANVNAQDNYQATPLHRAASQGHEKIVPILLNEPSLRINLTDSA
GCTALHLAVEEQREDIAILLVEHGADLYFENKEKQTPLALVKTSELRMKLKVAADRYSSK
TR
Download sequence
Identical sequences A0A158PVJ5
XP_001900774.1.25112 Bm1_46560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]