SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_46740 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_46740
Domain Number 1 Region: 180-307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-33
Family Galectin (animal S-lectin) 0.0028
Further Details:      
 
Domain Number 2 Region: 41-177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.04e-31
Family Galectin (animal S-lectin) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_46740
Sequence length 313
Comment | Brugia malayi Galactoside-binding lectin family protein (314 aa)
Sequence
MKNLFQVLVFVGLTLLEISLSEDDGRQPKEATYKKFVGERHYMIPFKTRISQPFQEGQTI
HGVGXIKSDAKRIDINFHKGAGANVDLPLHLSIRFDEGKMVYNSYMNNVWGSKEQRLKNL
FKPNXEMDIRIRIINNKYQIFANRMDAGTFEQRAPLDGVDHVSISGDLINLSLFHYGGRI
FPIPYMAIAEVVPGKRLDISLLPTGKRFNINLYNSNRQHALQISVRFNEGTVVRNAMQNN
DWGREEREGVIPIVKDEIADITIVNERYSFQIFFNGIRFTTFAHRGSPDDIRTLEIDGEC
EIFSATVNDAISI
Download sequence
Identical sequences XP_001900810.1.25112 Bm1_46740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]