SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_46750 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_46750
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-42
Family Galectin (animal S-lectin) 0.0000982
Further Details:      
 
Domain Number 2 Region: 146-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-42
Family Galectin (animal S-lectin) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_46750
Sequence length 277
Comment | Brugia malayi galectin, putative (278 aa)
Sequence
MSDQRSYPIPYRSQLQEKIEPGQTLIIKGSTIDESQRFTVNLHCKAADFSGNDVPLHISI
RFDEGKIVMNSFENGEWGKEERKNLPFKKGTPFDIRIRAHDDRYQIFCDQKEFKDFEHRL
PLSSVSHLSIDGDLYLNQVHWGGKYYPVPYESGISQGLSVGRTLMVFLCPEKKAKRFNIN
LLKKNGDIALHFNPRFDEKAVTRNALQAGNWGNEEREGKIPFEKGVGADLKIVNEEYGFQ
IYVNDVRFCSFAHRSDPHDITGLQIHGDVELTGIQIH
Download sequence
Identical sequences A0A0K0JMF7
Bm1_46750 Bm6267 XP_001900812.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]