SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_47390 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_47390
Domain Number 1 Region: 322-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000958
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_47390
Sequence length 921
Comment | Brugia malayi Nidogen-like family protein (922 aa)
Sequence
MYVYMCVRITAPLFSSRLFDYGPDVGDQELPRNLDVAEKINLIYPLRFYGVDTSTIYILS
NGGIGIESNTRTYQQNVLPSNLKLIAPFWNRNDLRNGGSVYFREVAAGRVLERGQSEIRY
QYDEVVKVKACLLVTWDKMQPVGAAPLPDDNTNTFQIALFITDNGTFANFIYKNIGWTQG
AEAGFNKGDRKEFFALPTSGTGNIMYLEEYGNTGIPGEWMFKLGDKSVERCKSGIKGDTX
DEECSAGEWGPDCALCCHCASGTCSATIGECIGGKCSDCWTGLPTCQEKREECEALMQEH
CAHNAMSFTDYDRCGEPIQRYIDECLQPGVCHENAICGNTPGHYFCTCADGFIGDGVSEC
ISSLLYSYRGHQELPKDRNARVVLQLKQPLQIFGKKLDKLTISTLGIISVEDSSKVNAGD
HLASSGIHGIAPFFANIDIRKGGQIFVDETDDPKVLSRATKTIASSINDKKFQAKTAVLV
TYINVTDADRTGPGSTFQTLIIGGTNKQHRNETYAQMLYKDLPWGDGAEASILTYGSKNP
LMLPGSGTNEIVHLSRSSNIGKPGQWLYRIDSNDVQMCLQPNLQPPYCEQYEVTDDSISV
TSPTLEEIEISEQVHRSSISEVDEPTDELVEIPGPQIIHPVLIDPPTSSHIQPXVETKPS
DHSSGNAKDGGWTRSPVTPHMSTADLVGPPGHRGFAPGRGDGMQDRQPEFLATTSTILAT
DPVVDDSRSEVLPEVSELPPISSTRSVEDVRPVQKVSMSTDSPVQTLVQEDERDYMTLKT
AYADETKVSSSTRYIFYNSARSVRCSKRSEGGSIQQQSRCYYSDGNHCSMVIVTRSYCIV
LLLPQEASGTSLQGHIFPESSADSSYYDNICDAKGFEEFRWFLRRSSRKSSTTQLRTEFL
QSEWSCFVIRFVLELSRQCFQ
Download sequence
Identical sequences Bm1_47390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]