SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_48065 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_48065
Domain Number 1 Region: 175-306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.49e-38
Family Galectin (animal S-lectin) 0.00023
Further Details:      
 
Domain Number 2 Region: 30-172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-23
Family Galectin (animal S-lectin) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_48065
Sequence length 306
Comment | Brugia malayi Galactoside-binding lectin family protein (307 aa)
Sequence
MSSILRKLFRNETKKVTQKNSITGRNNSFPVPYLSKLEGNQLQSGQSLIVRGYIIGRNEF
IINLTNGGKVEKENENDILDNRLLAIRANIALKRIYLNACIDGEWGREGSVKHKWTLGDE
FDIRIRCHDKYFEIFVDHKLLAKFAYYVPISNISHIYMNGDAELYTVSWEGKYYQVPYTA
DIPGNFYPGRKLYVSGVVKKRTKQFVVDFHSDNDIAFRFNPRIAEKKLIRNTRSEERWGT
EEKEIEIQFPFKKKRAFDLLFYCEENRFLCHVDDCLICSFTHRMSPRNIDKLSIDGDIEL
QGVHLK
Download sequence
Identical sequences A0A0K0J811
XP_001901075.1.25112 Bm2916 Bm1_48065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]