SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_48190 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_48190
Domain Number 1 Region: 386-412,478-525,668-888
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-47
Family Ankyrin repeat 0.00067
Further Details:      
 
Domain Number 2 Region: 210-550
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.63e-38
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 3 Region: 50-139
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000549
Family BTB/POZ domain 0.014
Further Details:      
 
Domain Number 4 Region: 1000-1050
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000182
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00088
Further Details:      
 
Domain Number 5 Region: 565-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000696
Family Ankyrin repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  Bm1_48190
Domain Number - Region: 882-977
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000273
Family Ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_48190
Sequence length 1072
Comment | Brugia malayi FYVE zinc finger family protein (1073 aa)
Sequence
MTNFEFLQAEHVKLLQNHADLQKRYDMLAAAVGFSNISVGDASKLSFVKNDITIYCDGHQ
FRGHRLVIATRTDYWDDLSRLDRIEFKDITYNTGCAVLKWMYTDHVDGLLGSRCLMEILV
AAVKYRFLDLQIRCELLLLDRIDCDSCLMLYDIATKNDLVQLKDNCEKMIKAKWNEFSAD
DFTNVSASLLYGLIKRLAKRFLPKLCNEEVSGTFPLELALESDQIEIATSLVNHHADVNS
IDNNGKTLLMRMLVKNKVNALIFLIQNGANFGQKVDITGENLLHIAASTKCSYELIEWLS
SNLNHFDINDVDNDSKTPFIKAVDSENIEIIELLLQKSAVDINKMDRKGCSPISSALFKI
RNMALAELIAKAGTDLNILYKGVFMIHHAVYTSNLDAVQFLCRHKVDVNKRTAEGMLPLQ
IVIDSENINLDLIRILMRSAANISLKISGSHETLLHHIIGSENDSEILEVCIENNICNED
IFTIVDTNGHTPIAKAVFSGKFQSAELLIKAGANVNEKDPEGVSLLMRTINSKLDDAAVF
LLDHGTDISGCISDKDCFSLAIEFSLLKTIRRLCAFAREGEKYINASLLWEALQQGSFEI
AKILTESGCHLNGCFYNENQKFHQTLLHKAIGLKLRDAAIFLIDAGCDIDISEQWQINGE
KPGRDTPLLACIRSDFNDVAMYLIKRGARLDRKDAEGRSAVHLSIYKKNIAILIELLNKC
NPDLLLDTDCSGNTPLDVAIETHNYLAAETLIKKAPKLITQVDENGEMLLHKTVRAIDLE
SVLFLISANFDVNACTVNESCVTALHLNAQYGSEIIMRNLILAGANVNAISTDGFTPLHV
AAYNNYEALCMILLENGAQPNVPDTLGNTPLHRAVSGGSVACVNVLIGDSRINLRALNKK
QQNALFLTTGDLSRTNSLDILQMFLNADPQFPLDEKDVDGFTVFLLSYLKGNENMCHALL
RCGVCLGTISQSGISVFKHVTPTKQLLFSLLDKLEREPCWADGHSCSECEMKFSLTMRKH
HCRHCGRLVCARCSEQEVPILKYGVEKPARKNLKGKLRTCLIKKNERFLTIS
Download sequence
Identical sequences Bm1_48190 XP_001901100.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]