SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_49410 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_49410
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000157
Family Kelch motif 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_49410
Sequence length 81
Comment | Brugia malayi Kelch motif family protein (82 aa)
Sequence
MTQRRSDAAACVMDGELYVAGGYTGETVLQTVEMYKPEMDICLACAARTDFILIADGYDG
INRLSSAEILRIESAHTVNVE
Download sequence
Identical sequences XP_001901348.1.25112 Bm1_49410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]