SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_49415 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_49415
Domain Number - Region: 2-45
Classification Level Classification E-value
Superfamily Kelch motif 0.000811
Family Kelch motif 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_49415
Sequence length 93
Comment | Brugia malayi hypothetical protein (94 aa)
Sequence
MGNYFYAIGGYNRMVTKTVVRFDCKKWERICDLSVSRSALRVVLLKAWPDPTKLLCNTNX
NSETTQNWTCEIESSESQETSSSQITDASDNSN
Download sequence
Identical sequences A8QCB3
Bm1_49415 XP_001901349.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]