SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_50120 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_50120
Domain Number 1 Region: 131-246
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-34
Family Ankyrin repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_50120
Sequence length 953
Comment | Brugia malayi conserved hypothetical protein (954 aa)
Sequence
MMFDGLGETQQTQQIPLYDLELSDDGSSSLISEREKRQVSCSGRRRTSGIRQRQGSSTSS
TQVSSSVANNGLQRAHSSPLPAYPVSIRQQLAIIKQMEEPMQVAADSSSLSLQLPQTXTG
SPGLSRRRISRVHKKNERGETPLHVAARKGEHQLCKKLIEEGAVINARDYAGWTPLHEAC
YHGHFKVAKLLLSYDADVNALSDCDDTPLHDAVTSGNEKLVWLLLHAGASRDRIDNDGKK
PIDICHSEYSGIRNLLSAATIPELCLVDESPSLSPSSPSHIQGSSQVFTANLIQLSAEKQ
CLISPNSDDFVANAETFSRGRDGEISEELGMQLQGSRSQLLSGGDFDKNTKSPDFDDVVL
RDEEVRVGIRHDFDDIGHSLSVHRSLWPEERNDALKRVGLHTGSSPYEFDHDLSPSHVSF
ENACFGINESNEAEIRNLEHPRNTYTERFSPQYTSQKSTYEKRKQRGRRRGRDISVTAGC
GTMAQASQSDDVYEFRSSPESDVGVNKTESVGDMERELSESPNLKRQRFNQTETTTVAPF
ASTAISETSSTQEGISILEKGEALDIASNXSDLTDEKADGTTVGRKVPPLRISLPRTPTE
DGTALTSSADDVTSVAMNAIRRNTRSTKSITRRNQSPEQSVNNTCDESIQRVTRSKLRQS
GRQLRDHSSVSFETSAKRKSNSWRRNSAAIGSPMPALSAATSDEQTSSNDTGDRADADES
SHLELAALKEDENALLALSLMKKNSYEGFRDFRCVNRWAKDATEEIVAPESPPNFKSYLI
VQGNYTSASNLDLLSSQDKVDLAFMEKLTIKLRNLHTEQQEKRRNMYFYHQVERERLQMQ
AESEVIRMLTRKANGHNGSFSTMRVIRETNLFNTGFLEVKPKKLPIMEISEVKVKYEKLA
EIMLRRQQMEADALYAEQIFIWNAAVQRSEDVTLSSLKNAIPHVSVNPVILNF
Download sequence
Identical sequences XP_001901492.1.25112 Bm1_50120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]