SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_50405 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_50405
Domain Number 1 Region: 8-48,76-368
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 1.31e-98
Family Glutaminase/Asparaginase 0.000000118
Further Details:      
 
Domain Number 2 Region: 405-584
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-40
Family Ankyrin repeat 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_50405
Sequence length 592
Comment | Brugia malayi L-asparaginase, putative (593 aa)
Sequence
MSTIHGEEARVLVLYTGGTIGMKCIDGVYRPEANYLLRAMRNMPLLNDCDYVSTNYADAK
TKPXCLPSLQHSKKRLVYWVVEYXPLLDSSDMTFDDWIKIGKDIQEAYDQYVGFVILHGT
DTLAYTACALSFMLENVGKPVVITGAQIPVFEVRSDGRENLIGALIMAAYYDIPEVTVYF
NNKLFRGNRTIKVDNSSLEAFESPNMLPIAHMDIDIKVNYDSIFRSPSVAPFVIHDRLCR
NVGLLRIFPSISIENVRASLQPPTEGVVLQTFGAGNMPSHRTDIIDELKKAIDRGCLIIN
CSQCVRGQVDVQYLTGKILYDIGVIPGSDMTTEAALTKLSYVLSKDCWGLSKKKAMMVKN
IRGELTVTQPKPLRDLEIVSQIARFLHLNTSHELEFLRHAILPQLLCHAADSGNVELLRA
LRENGANLSAIDYNGRNALHIAASAGHVDAVKYLLTQGVSFQLRDQRDENALVAAVRTKN
KVCIETLRSAGAVLSISPFQLGVELCLCASCGDIETLNSWLAAGADINQQDYGGRTALHI
AVESRNKQLIYYLLGRGADPDKSDYFDLTPLGHAKKLNLQDLVIKMKKREVQ
Download sequence
Identical sequences Bm1_50405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]