SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_50655 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_50655
Domain Number 1 Region: 16-165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-38
Family Galectin (animal S-lectin) 0.00033
Further Details:      
 
Domain Number 2 Region: 194-329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-33
Family Galectin (animal S-lectin) 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_50655
Sequence length 331
Comment | Brugia malayi Galactoside-binding lectin family protein (332 aa)
Sequence
MTSLTQLHSTVVVADPVVPYMEVIPDGLYPGRSIVIRGAVLHDPHQKRFVVEFCCGLLIQ
GDHQDDKALHFNPRFDTGSSWFSPPPDRQIVLNSLIGNRWGMEERYANVFKEGNEFSMRI
LVLANYFSIAVDGRHLCDYLHRIPITNIRTMYIGGNVRINTIKYEGIDNASTSKQVKLTD
EVGKLSSSNVIRKPKVPFVMRLNERLSPGIKVLVTGTPLMNAEYFTINFLTPMEHFFHFR
VNFSVGNEKEAIVRNSTEFGKWQKEEREMCSFPFRQGITFDIMFYFEEQHISITINGNHF
ANFHYRKFSKLIHIETITVKGDLSLQKIELR
Download sequence
Identical sequences A0A1P6BX96
Bm3068d XP_001901599.1.25112 Bm1_50655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]