SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_50955 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_50955
Domain Number 1 Region: 945-1063
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-34
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 2 Region: 2349-2459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 2990-3115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-28
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 4 Region: 3266-3369
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-27
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 5 Region: 3636-3692,3728-3787
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 6 Region: 2860-2984
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-23
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 7 Region: 660-724,751-813
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-21
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 8 Region: 2460-2571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-18
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 1182-1309
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-16
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 10 Region: 3377-3498
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-16
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 11 Region: 404-526
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000707
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 12 Region: 2153-2258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000903
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 13 Region: 1586-1695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000785
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 14 Region: 1308-1434
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000196
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 15 Region: 3117-3246
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000379
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 16 Region: 813-940
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000209
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 17 Region: 2273-2324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000068
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 18 Region: 528-662
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000103
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 19 Region: 61-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000328
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 20 Region: 2588-2686
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000144
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 21 Region: 1437-1543
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000034
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 22 Region: 3528-3633
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000484
Family Spermadhesin, CUB domain 0.0053
Further Details:      
 
Domain Number 23 Region: 1067-1180
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000183
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 24 Region: 190-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 25 Region: 328-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000786
Family EGF-type module 0.029
Further Details:      
 
Domain Number 26 Region: 3801-3918
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000523
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 27 Region: 1849-1928
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000118
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 28 Region: 145-276,307-325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000138
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 29 Region: 100-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000199
Family EGF-type module 0.028
Further Details:      
 
Domain Number 30 Region: 369-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000242
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  Bm1_50955
Domain Number - Region: 1717-1800
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0174
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_50955
Sequence length 3928
Comment | Brugia malayi Calcium binding EGF domain containing protein (3929 aa)
Sequence
MGDTATASSSQGDNNRYTIADIIKRLELSNSKKKDGSGRKFRNLLTALKSHIALLDNRLK
KDECSDNPCRNGATCIDLYNKFMCICPSHFEGETCENRVNECSIYQGTPAGCQNNASCIL
NADGFHCVCQQGFHGALCQLRATACEFSLDLCGPAGHCIPTQPDPETNEPGYRCLCEWGY
RSSADRNNPVCEDVNECESNPCYPGTTCINLPGSFKCAGCPPGMTGNGMICLDVDECASE
DLETCSKDPPVKCINTIGSYECASCPPGYKGNGHICKKQSPCELSPCHPKAKCYNMGMSS
LNEEGFRCECPLGMIGDGIGTEGCYHSNVTLCRADTCYNQGTCQIISEEAYKCHCKWGYV
GKRCELATACLSNICRSRGECLVKKDGSFECVCLKGYYGPTCEYEEDGCGGHIINETGVI
KYPDWTWYHFGRNKTCEWIIIVIEINFTSFHLPTRSATCAMADANVTLRDGEHANSPLVG
VFCGPRGSTTVPVSRPIYFSSNKAYIAFVSGKSSIGTGNFALHWRTVEKKCGERIYSDDG
QISLYGYKRSEICQWHVSVDPKMHIEITVEPMKLASGDIRNCSVNSLELFDGLEIDETER
ILHLCSSETTRTLVRTTLPYFTAYFRSNYPADFPEEHCDGDSLCSRGFTIHYRTIKLDKD
CGGTILPDADNAFEGYIQSPNYGFNYFPNLDCLWLLDASAVANAYDAKVIKVEIVDLDIP
SAPARSIKETSHFRLSFSESTAPNQRLVNLIRPCRFDHITFRNGEDTSHPILGRYCNGRL
PEGPIVSSGPKMVIQFHSNQSINGKGFKIHYSAACEKHFTSSNGTIQSSNYPNGSTQPFK
CTYVIDAEKTKAIRLKFNFIGLNTDIKTCFYDVTKHNLLEDYVEFSGGHDSHDQINKRYV
CARYPFVAPDGEMVTSASRSLRITLSSSGISNKGILFLYEQFDVGCGGIFEGESGQITSP
NYPEKYLAHMYCIYVISTPNKRIRLTFEVFELEVVPSREDCSFDSIEIYDTYVNDDDHSE
LHGRYCGTLLPPPILSTGNRLTIVFKSDRSVNGAGFMAKWQIVDDKIDCHRTYTATSGRI
IIHAETEMKFVQCDYQIALQSSKRILLRFENLSAPCDEGTLMLRNGVNEQSPGFGGLFRD
SEICDDHPVRELRSQGNRVFMRLTTRNAPSVMFTIYYQQIDSDCGGRLVGFNGALSAPQY
PLKDSRTLNCDWHIHVAAGNRVRFTITVLDDLNSADSNGFCSSFAPNYIDVAEGSSASAR
ILRRYCKKEISLSSVDSEKNELTIRYRQHGGTHFGSLFGFLAHYTTVCNQILLFGQHGIL
QSPGYPEQTLENRFCKWRIQTTKGNRIRLMFHFFRITESNARFTSTCLINYLEFGENQIL
ESSITIGGQQNHTKTTRKFCDHIGKPVWILTENEVVDITFSSKTEPENHFWLSWSNEGCG
GDITSPTTVIVHVEKLANNSKIYECIWKIVAPIGMRVLFYIKKLSIFEIAEDCNESDSEN
FSGLAFYSGTSNATGFAQKVLCSSREEDNYTSHTNELFVKFKIPSKLAKPDGKKRIMTGK
VSFIPAKTGDECGAVIEMGWNETIQLHSPNYPNLYPKSIECIWLIKAPSGYLIRFNLTHY
TALSYHPQRPDIKTWRSNFATNVTCQNSQSVLEGSVTFYNGNNTNVEILERFCHNLKQPK
IVISTTEQALVTFQGGPYERAYLSGDDERAHNIGFVLYISLVCGGTLYAGNELKTFQLYV
VKEDECKFLIKAEDGQRIYFRLDQIRFNIHRASKVRSKSSATVVIYDGMQEDSSTLGMYH
LECNPSNSEQISRACANRELRSTGSVLSVYLKGLNTIHLEHIHFSYSTQIESCGGTIHSI
AGVIYYPFIENDFECECKLKLPFSEYCAESYLEVRESNSSGKIVTRACSFEDVMPTMISR
AFWIRLRYSGSEDDSSDIEPLKPELMIKFKKVFGGMTNDGVVSSPIAEDWQSMHFTPVEW
TLIGEDDHWLRISIKSIDIPDERDENNLDIEQRDSLKGLVFSEGICTLNGKNDGCGRVEF
VHAGYIPPNDFFIKSNLATVLFNAPPGSSFRFVWENIPLTMVNTSLPKANQGINEDFMRE
FTCGGTLTATFDPQYLTNPGGMSTDGKFTTXLPLTSTIEVWRSINMYRLSRWRGGYGNNL
KCRWTIIRPMFAGVMLKIISMDLEEHIDCRFDYIAISSDLSGVSYDDGQLVGNVVKFCKH
RDVGTKELFSSEEAVTIFFMTDRNRGGRGFVIEYKLVCQSFDYIPISLGVFDQTIQSPNY
PNEYNNNLSCSWSIMLESSRPILAKFLTMDIEESPSCKKDGITVGFQLQLKEQIHDCSSD
RLILTEGDLPKVLTSPGFPKTSPNSLDCIWTISAPSGHRIKFTVDPISFNLEDSSVEDVC
SGNYLEVRDGPSKLSPLVGRYCGKEPPSTIFSTGSYLNIQYQTDSFVHFSGWNATYEIAS
CGGSVIIPMNGNRVIISPNYPEPYPSQATCDWTVVAPRGHYVNATFDHLWILFTENCTED
SVALRERGEYILKPVCVFNAVRGKHFTSSQNIMVVSFRSNNTVGRSNRLFCLEKKCGFHL
SLVPSKIECGGDVNDDSGYITAPGYPNQLQTHIMCDWTFRAGIGFRYVFDFAFVKHETKY
NEVGCYPDIYIANGLNRPVDYYGFVDHIFCFNETQFVSTADLITIRYDDRAAMYEKQNMK
ERGIPSEKVYAPFRITYLKVPAEFDENACMYHVRRNKTIELKSVDVSRYSVATSPDIDYC
HLLIERQFVAGTTVLRFKNFSSSENSFWKPNSRCLDTESYVLVTALGNEPWPFEARFCDG
SFKKTANFTVALPHRSFDIHVFQKLHLSSISFNLTVQFLPCGGLIQGPESGILTSPGFYG
KENSTYEPDTQCVWSLKAPEGQIVKIKITDMDLEYNVECKHDFLKLFEGGGTDASLVHVY
CNNPQDEPIQDRFREVKSRGRYLTLYFFTDMSIERRGFRLEYSFSGFEDECGFTTNRMTG
TVISPRNPQDYPNHIYCLWDISVPFGYHVALYFHRFDVQQSDDCSKDYVKISQEHHSRAI
APVGGYYFMFDHEEELKKICGYETPPVFHSESNRIKIEFKSDGKITGKGFNITWKSECGT
TFRLNHGVVTSPHYPRFYPNEDMECDYLIEPEYDGTLIITLRILDLELDPYIYDYSRQPC
NTDFLELRDISAKRVIDTFCANSDISSEIAPISVKGPVGVRFVSNTSVFEDLLNRRKHRR
GFKISYALSKCGGEINFKEEKELMSVVISSPGFPLPYHHNLDCVWNISAPEKRVISIKHT
HLDLEESSDCLFDFVEFFDGSQISNATSMGKFCGAVVPSSQLSTTGRFLVVRFYSDRSAN
RGGFRIIATASLGPDGGCGGEINVNNSYELIAPLNPKTGQYYNFLRCGWTLKAPTGKILE
MRLKDLELEAPDAETGRCYDYIAVYDGYKTISPMLLSNTCKIVEQLPLIMKSSYRVLHIY
FESDSDKTFKGFTMEFKTITAPCGGRRTAATEPSELQYESEKMLTRIFPKHQRCRWIIYS
KERMPLRVEFSQFSFPSLTPDCTDEYMEIRDAGTPADCHHPACRDTSNGLQIVRLCGSTL
PADFISGTSVIQITISAILQSEHTARFRLSYQTLNSCNRVIATQQSMTGHITSPNYPNPY
DHNSSCYTTLTALTGYQIFLVFKDFKLEKVRRSFNGQLSTSIREMLTGERNFGPFQNVID
QYSGLYRNEFCEYDYVEIIDSFENRTERYCDYKLPPSFLSSSNTLEIYFKSDSTMAPGGY
DAYYYTVRPSDSLSFVYYDFGIISEPQGAITNVGYPGYKNRQRMRWRIDPPNGHKCKLIL
LTMDFGKNINGECTEGDHLVLGEIGAEGSENIPLSYLPCRDAVTLPKEIPVEPGTSTLLE
FYTDDDTADNGDGFRVEWICENYYIMQV
Download sequence
Identical sequences Bm1_50955 XP_001901659.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]