SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_50970 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_50970
Domain Number 1 Region: 47-125
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000233
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_50970
Sequence length 440
Comment | Brugia malayi hypothetical protein (441 aa)
Sequence
MHHNDVLDITKITCSLQSETFIRERRKPMSKMNESENSRIQMDFLEVCSFGDLEQAKAML
ENGKIDRSFQHHGNGWTALHWAARRNHQEIVGLLLRAGFDPETPAKDGKTPLDLVTSEAV
KEIFKQSVNIKTNQKDFSIADGKECFKRVALPGCVSINALKLTIERAMKKGEVLEVITLP
DKVKIETEEQIRDLTNHQKVEVLFNSAVMNEEKNCVQKLSPHEDKVVHSECAPKFVSVIN
KYLNESASYGRSVDNIISLSDTGNSNDVDNSFSGMKGSDPISNEQMMNMKISEVAVTSEC
FLTNHSFSSNTNITIPPKILVEEMIQLQMISSRQSDDEIDLDKSVQISKSETKNDCKLAE
SGSEIGTESSVLSLSPEVDVNNSTVCYITESNCFAAVQEEWDKIIVQDLSRKRTLQITLV
IGCIVGFGGLTYILYKKWKS
Download sequence
Identical sequences XP_001901662.1.25112 Bm1_50970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]