SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_52030 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_52030
Domain Number 1 Region: 769-1072
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-74
Family Protein kinases, catalytic subunit 0.000000761
Further Details:      
 
Domain Number 2 Region: 202-370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000427
Family MAM domain 0.048
Further Details:      
 
Weak hits

Sequence:  Bm1_52030
Domain Number - Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00412
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_52030
Sequence length 1269
Comment | Brugia malayi Protein kinase domain containing protein (1270 aa)
Sequence
MFRLFGDPDATLIVTSQHRALSEAASYTDLYDYEDETEWTRPTLHSTFDSANNYIDSWKE
VGVHIGHVTHPTRIRIECHSKGSGAVGASKGNTECYIDNIEMVKCDEEVWYENVCQSNKT
KKYLCHKYDHLKCIDYDQLCDMTVDCPGAEDEQTDLHNCTVVPLGARCTFEDDNEEKTGC
VGWRLETXYVHNSRRADENKHLFIRVNSSGAAKQSSLKHVPXRDHTFEHTNNSGHFLYFT
SEDGQDRNSFTDTKSTYLISPYFPPTVNVLLNPVALLSNSCRIRFYYCSYGSAVSTLQLT
VHPTNGQPPKIIWTPPSLSFADHSYYCEWMKVSVDLPEQKSEYYLKIGVSKIFDSSISFA
IDDFSMTPDCFANEAWRTQYVPYVYNITSCGRQGAQPPTPETCENFYNQRIEAYGASGGH
LAQQTINNYGGQVISVLNLTMGMELNILVGQMGESPCDHFNTSADDMKSYQYEVLKYLCK
KSSSIWNDNSALTNAVMFPGTGGGGATIVKYQNMIILVAGGGGGIFPEQIISLEKPGVNP
RGGYLFEADKNSQSNDYYNPKRGIQWMAGDGAHLIHDNEKDKCEQCIVMSGQLNNVSSAG
GVCPLVSVWKILGGYGGGGASCGPGGGGGAGYHGGEGGQKYHGDGGKSFAHYKSAIVRPG
MNSGNGYVLIHPCRLRCSQNATCRFRFDNTAEIGSYCACPDGQVVGELQDCLFGENSVYF
RRRLKKAKIEKVELNREIGMCALTPSTPMSISGNPIYEPFGPCAELQPIPRANVALIRPL
GQGAFGEVYEGTLNCGSQSVQVAVKTLPKTASKQAVNDFEMEALIMSKFRHENICELMGV
CFDVTPRLIILELLAGGDLKSFLRECRPKNTQDQRIQMIDLLDMAQDVAKGCKFLADNRF
IHRDIAARNCLLTKKEVGRVVKIADFGMARDIYRQDYYRKGGKAMLPVKWMPPEAFLDGV
FTVKTDVWSFGVLLWEIFSLGYMPYPGRSNQEVMSLIVNGGRLEPPNGIPDQIYSLMLAC
WSTADTDRPHFDYIIENLDSMLQNPVMQSMPLPAIIHRLSQSQSAPNNSSLPESPSSVTE
TMSQNNYSQSTINTILNSYTETIPSNDCDPLPTKGDGVNFNVCTPYHPQSSEPFCTLDRT
QSRPLSLWANGQLPSGSTETCDSGEAASNCNDNVLSTMTLHNAVAGSRKPVVDVDSCNNR
SISSDYANAIRTEVVSLLEKRYPPPMKLVLPSSTSDDFLSPSVTNSLKSSNSSNHQSLLQ
DCMNQSQIL
Download sequence
Identical sequences Bm1_52030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]