SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_52055 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_52055
Domain Number 1 Region: 210-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000302
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  Bm1_52055
Domain Number - Region: 133-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000753
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_52055
Sequence length 469
Comment | Brugia malayi EGF-like domain containing protein (470 aa)
Sequence
MLILQIILFSTLIIIASPESLENNFTTKSTKAGHSSLWLARSFRITCCLSGYPVPENPKI
IRNWTHEESDYITDERYGERTISSSSSSSVGSRTRGVAKEEVINSKCRIYRGTYLLSSSA
LFTFDDFTGIGVACKCPEVSAHEYLDRNCRRLKPCLNNGHRSFDSSLYCICPKPYFGEQC
EKYCDQGQRMTGADGRDYCSCTPFYQGEECRNIVCLNGGTELRHQCLCPPNFLGYHCEID
ANRTSVMLRFHGYREQNVYQDSDLLTRDVSSTIFSLVMIAVLILSMYLLMKHRMQVQNRF
ASVRREALVRSSIEINSRHGNVIVSDDSGIPSFRTITFPNEGPPPYVIIPHRGRSCQRGD
NLPPLPTYEDATKLPPFIRPPVEERSTEEEEQVIENVTSPSELQINERVMETDTNDESLV
LCSLSYPRESQHSLETATSGSGTALVHMHIFNTDNSPLPNKKLLTRRSI
Download sequence
Identical sequences A0A0K0JLB2
Bm6008 XP_001901879.1.25112 Bm1_52055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]