SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_52405 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_52405
Domain Number 1 Region: 2666-2761
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000534
Family Cadherin 0.0028
Further Details:      
 
Domain Number 2 Region: 766-955
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000112
Family Galacturonase 0.062
Further Details:      
 
Domain Number 3 Region: 620-792
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000386
Family Pectate lyase-like 0.061
Further Details:      
 
Weak hits

Sequence:  Bm1_52405
Domain Number - Region: 240-266,294-476
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000314
Family Pectate transeliminase 0.072
Further Details:      
 
Domain Number - Region: 1089-1114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000825
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 68-270
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0241
Family Galacturonase 0.051
Further Details:      
 
Domain Number - Region: 1197-1263
Classification Level Classification E-value
Superfamily E set domains 0.0263
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_52405
Sequence length 3005
Comment | Brugia malayi EGF-like domain containing protein (3006 aa)
Sequence
MSLNGRKLHKQRKHRNQRFLVLEKRRRMRRSINFEKVLEFTPKNSPYRISKNVTVHAEQI
LKIHAGTDITFSQNTGIIAHGVLQIAGTKYDPVILHEMNGTWNGLCITFANADVAEQSRL
TYLSVSGSKFGIRIESSLLPQIENIISNNNDNGLTILAYNDNNNFSDKIINHTLKKVTAI
NNRENGVSVKITKQESGHFVLEEIVSESNQINGLLLEGTLHVTVISSQFFSNNENGISTY
LANGSTLEVYDSFFGSNGQHGLQIQNGQQVQVKCFSTTFKAHNSGEAILVKNISGANFLL
GDCRWRSNNGGIVFRDVTDSNLHLLNGNWMWNRGASIIADKIKGKTNILIENNKFRQNVF
HSNTTLNSVIELGMNENDKDARIQINDNRFLRNAMEIILLIGRTEPRNTPTNAEIIIAKN
SFLENLALNAVYLAANYVNISYNTFHNSKARCELHSGLKLSIGTSINAINNYWGTANQGE
VMSRICDNKRDKSLIPVIATPFLSVEFEKLPMIGIERSGNPSSLKAYATFCKINFPPALS
IVILSHTSDIYDNQKQIFKTITSTAKKSFETQFFNWSEKFRFATSLIIGKDEVAVFHKGS
ALHFKPNHGIIVFGVLHLLGQQDHPILLKSSGHAPWLGIILNQGGIIHASYCILENVKVG
LNVSSSNISIQNMRIIRPIFTGILITTTYNGTFDMGESVILQSRANGIRILKRQINDTLA
IRNVQIIDCAEAGIDFVDPAGKIILQNIVLENSGSFGIIIVQREQNGLDSIVLNNLTVQK
QERGSGGILLNMKSYYSLCLNTSNFASIMLPSVIIVSKCPLSGKKQRVPTIFIEKNHFSK
NDNLAMRITLEGCENTKIPRNTFIRNNGNGRKGTLAIYVSPMKNIQPGPAVNISQNIFVE
NKGEWSLLASATNMNRFNGTIQNNRFSGNQNSGDSLIVTTSHFHVSGNEFENMVSKHANK
ESLNTGQTQINSIGRKRAAQDCLSVSNCSHNGQCIGLNVCRCNVGYTGPDCAKISCSALK
NCSRNGYCIAPNVCQCFDGFQRQDCSEPTCHLVNNCTGHGTCVSLNECDCEPMFEGVDCS
KQIWNCSSINCNNHGLCIDNACVCESGWAGPFCSSALCDQLNNCSGSGTCVRPQMCECFH
GFTGDDCSICEGPICDLCDAKCIHGRCNLNTRTCICRSGWAGPNCEICATDKCDVMPAVL
YVLPTAAGIHQKGENILVYGNDLPFVPSRRYTCLYGSIASDGFYVSSSLVRCTIPDLALP
GRYLFNIIPYGSDKVVPFLDKRLIHFTLYNECNQAECKGYCIGAICVCPTGRDGTFCEQT
KVLPKLDREILSNEKLIQAVEGEPYTVKIPIQQENTIFNVETDAKGMIIYPNGMVFWAQP
IGRVQPYTINVTTASLTGGSAISWNLTVKPTYFPVITKVESSDDSNMKVIKGIVNYNEKK
PLQLIGEVPVEMLVYQNGEMVGNALTTSRADGHFNFDYYPFDETISTSVVVVHPGAARPT
ITTSSNNVTWAAYKFDIKYAPKIKMKPGAQIDEEYQIKNKGGEALLNCHFELIVPRDKIQ
ITKYEKVTKGITVGESKSIRVTFVAGNTLDNTTLILQFKCINTPKKLVRQQIEVDRKRSI
FVSYPPEILISIPTRMSPKIITVNIINKEGYRFVAAPRISIRPDQSPLFLVSTKPPLQNI
TEFNNPESVLVLFLSYRPLPSGVLNWTTAGDLILLDGNKQLFTIEYRNYATSDLFDFQIT
VMDEMSALDPTHIVNDAEIILRNDVLGYDDKRQTKPDEPAVFFSIIEGTYQLTVKSPSHV
SVTLIVQPSFINSSLAVFVPIISPYYPVVEDGKLLVEELDEQQKVPFPKLHFIPSAILPP
INGTKEVKLLIRSDLDGPSDNIAVLPSVEIHEEYVPFTFATDDLRNGLGRGDGYYIKCRL
SRVLNQARETAPCTVFALQIPYIYMVSASISNYARNVMILADNRHKQDDKVHLCEVGLQS
AIKEVSVWTKSTIYCNCAIKMKKRCHKQYISASTCGSAWKYIPNDTVSLQTTAMFIVLIA
ECHTAGVDFHKIRQFLACVSLLDNHCLISQQRSFTKNKSLWESEQRTQFFDQPAVANKQT
DEILQKYFPMLKILASQTVDVIALYKDFFERLNVLLPFKFFEEINNIQWFDNFFESISDL
SEGGLAITGTEFKKLKDEKGGSILALRWNSTVTEWTITPDTSLKANFLGMKFADTRELII
SSDRLKTLARQYGAANPFTLLHDYMRKLLSWHSKNMSDSQQTLTPGNSYDDICACAYSLI
TPEKPYENSEFHIRLKVANKKNEPLESIKVTLEMIQSDTDTVSSDDTTPIQFRIRLVMLD
GIGSIDRASKLSPNTSFVANWNLKPVKNVRLIREVEYQAILILKFTQNGRRSVQRIATQT
VVLQPRPSLKIYYFISNSALSENTKNSNVSLPTFNMMIAFMNTGYSNLKNIKVEEIRISV
LSEDNVENFIPYQISGVINGNGIEDRILSDLHFIIPNIESGKTKRVIRDFKMTTSMNGEL
IKLEDTQTFTIQQFISSTKFLVSPHTNPALLFYYDVQKAVEEKSGNSDGKPFRQQIASFR
LSESQQQLTSFYGRIPYPTDLEHDFEVLRLNQIGKNGALRLVDPRHVWTSNTDPEFVHFI
DDNPSATSESIEYEIIYGNAELFLRPHFEFPIYNVPLVTENWPHVGDEIARIQAISPSQS
SIRYELYSNSGEMDDYFSINPKTGVINLMKEILPAEIENSYCSTVRATDDHGRSETTALT
IGLDGFVRECHKIDNFNGLQPLTYIPTQSHPSKPVTAISVTKNDTSEIPKSHVTAPSLSS
TLSSTTAKIDQEANGRYRVMSLVTRRHGYTKLIATQSVSDLNHKSALTLNLNLNSHLQLS
STAASVSRTNSESYSSVFLGTTTTSGVTTERDLNDAFFSTGFGTNEMVYTTDGTINNVSF
STGKPYETHVTGGAKGITLLSHKEMHGGSDRTSRGEITWSDSFSSGSGDAKIFNERKNKL
RYSTX
Download sequence
Identical sequences Bm1_52405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]