SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_52555 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_52555
Domain Number 1 Region: 425-648
Classification Level Classification E-value
Superfamily GFP-like 4.08e-48
Family Domain G2 of nidogen-1 0.0000618
Further Details:      
 
Domain Number 2 Region: 1416-1619
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-38
Family YWTD domain 0.0000098
Further Details:      
 
Domain Number 3 Region: 758-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000752
Family EGF-type module 0.026
Further Details:      
 
Domain Number 4 Region: 710-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000381
Family EGF-type module 0.045
Further Details:      
 
Weak hits

Sequence:  Bm1_52555
Domain Number - Region: 1146-1273
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 390-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000665
Family EGF-like domain of nidogen-1 0.014
Further Details:      
 
Domain Number - Region: 1104-1136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00689
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 874-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00694
Family EGF-like domain of nidogen-1 0.092
Further Details:      
 
Domain Number - Region: 1342-1379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00787
Family EGF-like domain of nidogen-1 0.045
Further Details:      
 
Domain Number - Region: 1011-1084,1128-1187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0282
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number - Region: 1652-1678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.031
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 939-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0896
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_52555
Sequence length 1682
Comment | Brugia malayi G2F domain containing protein (1683 aa)
Sequence
MLFLLFLYCTILLTTRSHGAELFEFGVEQGDQVLSFSNDSYAVTLDVPIIYFEESQNELF
ISSKGIVTFGKAADVTEMTDLDQERINAIAIFFAQNSAGKIFYRATSSDTNLLNDLTDKI
RKNFPNRELSDFTALHAVVITWSNIEGEDAEQGLNEFQMVLVTDGMSSYVFLIYDQITWT
GKNGHYAQAGLYCSDGRRETMVNSGTPNIRELVNLSNNQKEGTYIFRISGATPEDPRGTL
VEDDYNYNDYEQDYDSDNEHKRQHKLLSEHCPTDPYRDQCPVECHVLTDDRGCSLCVCAQ
PPDLNKIEKKDDEMGKVXVPSQREEINVGPGESTTREALQEQDIRDKEPKPDDEGEGESK
LIIPTESKNSESIDDIEGTALSCAIASKKVQPCSLHAKCNDYNPGYCCECLPGYYGNGEE
CLKDGEPQRINGGFEGVINGKEMDRTELHTYVMVEEGRSYTALSQIPPEIGRSLLLLNAI
GSAMGWLFAKVVSSTSYNGFMLTGGLFNRTVNVHIGDRYMVTIKQQFSGRDIYHYFKAHV
SVIDTKMFISGTLPILMEGAEVIYSDHDEEYRREGPGFLRSYSSQMVTIKENGVETQMKL
STDQQIHYKECPFREFTKDPVVVIHVSRIHVVYDVEEHIVRYASANMATKRDSNIMIAPS
GTDHHQLLHTNQQSLQQQQQQQYRNQEYHLQKENVENQRPPCTNCLQNACESGRHLCKSP
NMICAPVERSYRCECVKGYQAEYDNDTELGWKCIDMNECERGEHKCNRNAICINLEGTFE
CRCADGYEGDGYHCRKVRVDGELENKRPLTGSGCLDHRDCHQWGECIFGRNGELGYCKCR
GWYTGDGVHHCGPPTETEVKQVVIEDSNREQAGQTCGEYMCDVNAYCDSSSGSEQCECQK
GYHGNGISCVPHFSDQKKPNATGDSGDISVGIGKICRSHDECGKHGNCVYNNELAVYRCI
CVPPYFSDGVNCVESKGGNNSSNEFLEGVSCNVINNCNTNADCIFEKNDRDESVYRCRCR
PGFSGDGHRCTMTSLDNLPAYAVLGCDQLGNCDLNAVCVLDAYTGRHYCRCLDGFDGDGY
MCETVRQNTLLPSLLPEPADAKTCREASDCHQNAHCVVRENSLDYFCECLPGYRGDGVTR
CTAADDCTPGDEHACHKNAVCVFGEVERTYTCKCAQGFVDDGRQCVARHLTECNEQPGIC
HKNAQCVYSRDEGRHKCICKDGTTGDGYENCREEVKMHRCGECSSHARCMHDEADDSWRC
RCMQGYIGNGHLCTLYSLSLILVLSLTLHYDVAFISRSRQMEVHKRRSTLKQLRHCVNVA
NYILITNIALRVIYSDVMCANCLDDRSLCDEHAECVPNEYGHYICNCHYGYHGNGRTCTP
DSESREEAIFICRGMTIIERSVNPDLPGKQLIVVPHQIAVGIDFDCQEERIVWSDIAGHS
ILSASINGTNEQKFMDTVLKSPEGIAIDWSSRNVYYADSVKDEIGVASLDGKYYKTLINE
GLVNPRALAIDLTDRYLYYSDWHRENPVIGRVRLDGTENSAFISTEVNLPNGLTVLLERR
ELCWVDAGLQHLSCIGLNGQNRRVVYAPLQYPFGLTVHNEQRFYWTDWSDNKIHSVSVNG
DGYISFPATTGGSGRLYGLVSVPLRCKGVATACAVNNGGCEHLCLPGKIDVTCACPDNID
RC
Download sequence
Identical sequences XP_001901979.1.25112 Bm1_52555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]