SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_52815 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_52815
Domain Number 1 Region: 33-228
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-18
Family Ankyrin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_52815
Sequence length 437
Comment | Brugia malayi conserved hypothetical protein (438 aa)
Sequence
MSVDGMEASNLLYMTDTSNRFAQRFTHWIRSFYNAAVDGDIEEFMIMFNCILQILKKSAG
CDYYKRMSGHHLKEHVMNNVICAFFDKSENTSILHLLSPTKNTDRPCSMRNHGYCRLIKM
ILSMLPWKSRRILLATSTKRTGKTALHLAAATGQPCQMQALMDFGAWPDFFDHSGRAPIH
YAIMRNNLEIVKLLLWYGADISLRERSATPLQLAGYSPTTTSICDYLHARVNALEKIFMQ
WIRKYVRGVWTPVHAISDLHFARLSKACDSGRDASRNFTTKNRKIHINISKTRNGNPQLK
KCPLMLLFIVPTFYKGEDRIADASNPQIFCAKMQNVNGFVVKLLPSRPLLSCSKWSIGIK
SALEKPHNGYFYVYKLPENIEVDSYTLHLMVELEELRFQAPHITLAIQAFACGPPDLEHY
NELRGFVTHSNNKTKTD
Download sequence
Identical sequences XP_001902031.1.25112 Bm1_52815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]