SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_52950 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_52950
Domain Number 1 Region: 23-199
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-31
Family Ankyrin repeat 0.00085
Further Details:      
 
Domain Number 2 Region: 257-386
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 0.00000000576
Family beta-N-acetylhexosaminidase domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_52950
Sequence length 924
Comment | Brugia malayi conserved hypothetical protein (925 aa)
Sequence
MLVRNGIPNNITSNYNITANNEENICSLLLKSVDDERVDVLRSLLEQIDSVDSVRTLLSA
GVNPCVQNDSNNTAYRLASSEEVKNAFVQELLQAVAQSNLGRVCQMISAGVSVDSIDTVS
TGNTALHWGASYGNEDVVRILCQSGANINTLNTKNETALHDAVRRGNEAVVKCLLSYGAD
PSIKNKSGEDCYELAAKMGGTMLPSLSLNTLNRKIRRTTSIESEIDRSSLISTDTTTFVE
KTSNYSAGRLENWIDLLWPQPKYIDLDERDRTCPYPKDGRLKIYFDKASEAEPRRLMQII
QMSAPILSTVHLELDYRGHGVREQSSLDGRITCGIFKNGCCSGAYTLTIDEDGIEIYGED
PTGVRHGFSTLVQILRIFKEGSEIVNSNTETSLITLHETLPESTAKITGTVNNEQPKKIG
AIPCLTIRDSPDSCFRAVYQDFSGCKILNTETLLQLATRIGYCKASHLFVNFEVRTTDRY
QLPYTTRDLFQITQVCDELFIKFVPSLDVQSSYIELDLAWRTIDSFLDDFPLTKVVHFGP
NLAVMVISNRTILNNVQRRIPKIYISVDIDKNNASLINHLPPFVTICVEGKYPFEAENLL
SPRLNVVLRFSTSDPGFLCAAPESVAKKALLATRLGNKFPILGTMVCDLSTGCEVMPPSL
SYMSELASLGVCWNKSVDVKRFCFLLPRITAEHFLLDGNMEALFKQMSTVGKVEHEITRY
SYGLKVTESTEEVQEQSPSPSSNKKRPISVFVEMILNPDNMVLERLTPVIFKKARIELKR
SLKILDRAKKHLPYNYELALVLAEIQIITELMVLACKLGQSLCTYGINPSLSPKNQKSSF
SPSDRLLQETSLVGYEMVNIGVSNLPPVVRTDLANRLLEIRSRFQHTWLSRNIASTLPNA
LKIFDNLFRALLPPNMQDYGRNLL
Download sequence
Identical sequences XP_001902058.1.25112 Bm1_52950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]