SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_53050 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_53050
Domain Number 1 Region: 152-350
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.06e-58
Family Reprolysin-like 0.000035
Further Details:      
 
Domain Number 2 Region: 365-430
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000218
Family Blood coagulation inhibitor (disintegrin) 0.00058
Further Details:      
 
Weak hits

Sequence:  Bm1_53050
Domain Number - Region: 561-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0661
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_53050
Sequence length 845
Comment | Brugia malayi Reprolysin (846 aa)
Sequence
MQDGIYCPLHIYYGEKELNANELISISHTVRPTFELRLQNDVGESRNFVFQPNRELLKTA
GKTALNNLTFSVNTKIHLDNVKGIKRTSLVNQIFRGLFTINGRRFVLGANPNASFHFVPL
SDHSCDWGLRSKRSIGGSHTAEYYAQFLDDRWRYVELALIADKLVFEKYDSNVTEVMQRL
NAITSYINSLYMPINIRVVLVWADVWTNSNQVDITSNSDTTLWNFLNWRKTLLKDHPHDN
AHLLTGVVFENNVVGKAFKGTMCSYDFSGGVDMEHSDQAAFVAATIAHEMGHNFGMEHDI
DEVECRCPAKSCIMSPSTGIIRPTFWSECSMRALQHSFSRGVDYCLRNSPTSVFGGARCG
NGIVEVGEECDCGTPSSCINKCCNPVTCQLAEAAVCASGECCDLNTCQMLPATTDFCYNG
YCGSRDAQCQYIWGRTGRDAAPVCYDLNLYGSSGGNCGFLHETNRFVPCHKNNIKCGRLH
CIHENEKLAFGDPSTVYTSYTGLKLSSGEDVACRVIWTKYISGQKEPDPGMVPDGAFCGQ
DKMCVDAKCQNRTAKVLMAPKCEPVSCNNAGICNNMGNCHCDPGYGGPSCAIPGPGGSVN
SGPAIEGGVIHVGFVVFWLLLILTITFIGISIIVKRKRDFWLHKEIWEKLKKALKIEKLL
VPIRKAPPPPRSTIRTADLNLIWGDTASDALRVRSYHQPLPPSISPPVVPSTTLNLVPTK
PSVIAYRNSMRPTTAPPKVPQRPRSEALQALYAEKGEELSMNLTKQTSPMYCIPSEANAV
KRIETETFRPVQAPPLPPHHNHVLAKNNALSDNRDKPLLAVKPSSVKDIAARFDPKTSQV
STKFI
Download sequence
Identical sequences XP_001902078.1.25112 Bm1_53050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]