SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_53560 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_53560
Domain Number 1 Region: 17-108,145-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.39e-79
Family Leishmanolysin 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_53560
Sequence length 267
Comment | Brugia malayi RH66426p, putative (268 aa)
Sequence
QCRYCTSPESRNCGIIGPPDGIGIPNTDFLLYVSAVLSQRCKNIDTVAYAAHCQQEADLD
RPIAGHVNLCPNALSTALHDREVLLSTVKHEILHALGFSAGLYAFFRDDNGKPRTQRNRY
NKPISLNKDRGYYNWDSNTIQTIIRNDWWTAEGMIPHPVHIMVTPRVQQEARRHFNCSDL
EGAELENQGGDGTAFTHWEKRLFENEAMTGTHTQNPVYSRLTFALLEDSGWYKANYSAAE
ELHWGHHLGCEFARKSCGEWIRNRQEK
Download sequence
Identical sequences A8QFJ3
XP_001902178.1.25112 Bm1_53560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]