SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_54225 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_54225
Domain Number 1 Region: 29-144
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.17e-22
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 328-371
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000209
Family MYND zinc finger 0.0092
Further Details:      
 
Weak hits

Sequence:  Bm1_54225
Domain Number - Region: 109-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0743
Family Tandem AAA-ATPase domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_54225
Sequence length 429
Comment | Brugia malayi MYND finger family protein (430 aa)
Sequence
MNNLEASTTVPKYDQEEAAERIFDMIKEKNAEEVLQILKSMRIPLDYTDKTGMSLLDQAS
WSGLEDVVRFLLANGVDPNNSTHDSGYKSLMFAAIAGHQGICQLLLDYGAHVYSTNAIGK
TAAEMAAFVGQHECVSIINNYVALDEIEKLLHPKGNDSDEIYSKEFSRALHDLIKTHIIH
PVWVMLFLRDHYQLIWQHRQKFCYVLDRIFERQLRCKESNEVMSLKLWLILYTVRDTCKF
VETALEKEGHKASTIIRNYIKQLLKMEQTYRIRPNLERYLRNAVQAFPYHHCLLFQALIK
NLAAVEFGSLPDAFYLIMSVFSGQRMVETSHFCATCGAVTSTKRCCKNTYYCHPDCQKID
WCNHKMFCEKVYKGKQGEKRRCSLRDSAASKTIVQNEGNTSSDGIIRDGQSKDKHVEKVA
SALADIKFT
Download sequence
Identical sequences A0A0J9XMQ6
XP_001902304.1.25112 Bm6662 Bm1_54225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]