SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_54300 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_54300
Domain Number 1 Region: 87-150
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.3e-19
Family PHD domain 0.0031
Further Details:      
 
Domain Number 2 Region: 41-101
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000096
Family PHD domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_54300
Sequence length 164
Comment | Brugia malayi Hypothetical C28H8.9 in chromosome III,
Sequence
putativeXXXXaaXMLKLDCLCCLRVAHDECFSVLSPSIDVSTVCDLCLGDCNQNKKTM
KPEQLISCHDCGRSGHPSCLKFTDNMLTSTGKYGWQCIECKSCAICGFSDNDDQLLFCDD
CDRGFHLYCLRPPLPQAPEGEWSCHLCQKQFGAQASLPVVNTKK
Download sequence
Identical sequences Bm1_54300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]