SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_54385 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_54385
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.12e-62
Family Lectin leg-like 0.0000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_54385
Sequence length 290
Comment | Brugia malayi Legume-like lectin family protein (291 aa)
Sequence
MGIPYWDIQGTTIVTGQYVRLTADTQSVQGGIWNNVPVNVRDWELHVNFAIHGSTGDLFG
DGAAIWYVQDPAQTGPVFGSKDYFRGLGIFLDTYSNHNGPHEHGHPYISAMINNGSLHYD
HDMDGTHTQLGGEHTGCEAKFRNKQHQTQIMIRYVGDVLSIYTDVLGTGQWKECMSVDGV
QLPTGYHFGITAATGDLSDYHDIISVRMFEQEFAHVQHGTGVTVDPRQREPYAQNVAAPR
DHIDQPPASKLGWIGTTVLVILGGALCVLVLWFGVIFVNHRQQMSRKRFY
Download sequence
Identical sequences Bm1_54385 XP_001902335.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]