SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_54710 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_54710
Domain Number - Region: 64-81
Classification Level Classification E-value
Superfamily Notch domain 0.051
Family Notch domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_54710
Sequence length 83
Comment | Brugia malayi hypothetical protein (84 aa)
Sequence
MDCNSYSELMHLWGIDRIDSKRGFSWKVIFDRFFSKFHYDKFASDVSADEMAHTVELAER
MANFVLEDECKKECNDHECELQN
Download sequence
Identical sequences Bm1_54710 XP_001902400.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]