SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_55135 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_55135
Domain Number 1 Region: 138-218
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000237
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_55135
Sequence length 247
Comment | Brugia malayi IQ calmodulin-binding motif family protein (248 aa)
Sequence
AFGVSKSVTQNPRYRFSSTENSIEISFVSARKVRNYSEKEKKAALLIQSWWRGMKIRRLY
RVPFLQKRIQRFETLLREKSNMILKLKNQLANLEYNIETIVAVNEEQAMKIAKMEQCLAK
ISETCNERQKQFMNKLLPVPDELQYIRKSDTEVLLQWQNHQRPQKPTRYLITVNGNPCGT
VRGLHKKVLVTDLDPTKESVIRMQCVFNEFSGDISECLVIPSHKQETSCINEGEVESAPS
QIEFNLD
Download sequence
Identical sequences XP_001902485.1.25112 Bm1_55135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]