SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_55365 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_55365
Domain Number 1 Region: 292-545
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.19e-62
Family DPP6 catalytic domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 24-213
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000294
Family DPP6 N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_55365
Sequence length 562
Comment | Brugia malayi prolyl oligopeptidase family protein (563 aa)
Sequence
MNKLTKQLLLVCKFTIPGCSPARPMKYPVAGTANAVSTLRLIVIDGNKITDEKLAVELKT
VYPWYEYLARVGWLSDGSAIWALLLSRLQDRYALVLIPLNLFGSRDNQSSAQVVTLLQEQ
SEIWFNVDNLTRFLTPVGGILQFIHASDRDDYTHLFHYTAKLDEAHVTATCSSRPVTAGD
WSVLKEPGLFVDEKRKHVYFVANKHHPSDSNLYERMECELQLNPEIGFVCWESSLQMPPR
CVFYRLHHLNGDRLPTATLQHFIYLPQQSLANELSQRIENICVPKVAVKDYPELIEYQSE
NSKRKHYALLLKPFGAIRGLQYPVIQLVYGGPGVQLVRNAWSTWVGFRKFASLGYAVLMV
DGRGSSNRGISFEAALKNKLGTVEIEDQVEGLREVAKRTGGLLDLTRVAIMGWSYGGYLA
LLCLAKNPNVYRAAIAGGAVTCWRLYDTAYTERYLGLPSDPIYKDSSVLSYVNQLPNEVD
RLLIVHGLIDENVHFSHTERLIEALIAAGKPHRLQIFPSERHGVRSVEAGEFHDASMLSF
LCRALAVDRIHSDITKNTDKSF
Download sequence
Identical sequences Bm1_55365 XP_001902530.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]