SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_56165 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_56165
Domain Number 1 Region: 35-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000013
Family EGF-type module 0.004
Further Details:      
 
Domain Number 2 Region: 74-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 3 Region: 115-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000939
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 5-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000192
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_56165
Sequence length 338
Comment | Brugia malayi EGF-like domain containing protein (339 aa)
Sequence
MIRTSGGKCVKKNVAGDYDCLCPLGFTGRHCEENSNECAQLNPCMNGGRCIDEVNNYKCQ
CPDGYSGTLCQDSVSACLNEPCMNGGQCIDIEGGGYYCKCRIGFRGSNCKIAEIGCHRSS
CSNGGTCVDSFQGFRCLCPPCFYGESCLHLQSECQPLQHYNRTRTFVVKIENEQQNDRNS
RILSKYSEQKPCLSICTNLDAEINYFERDVTNKIQTISGKKKLAAHPGCEHLDYNERYAI
EPTVNMMLPSLKNVGCCNKVDIRHSKRFEHSPLPTQLCEDGGSYYEEIDGELSIPEVISQ
QTNNESQSNIVNRRVTPDNNSRQVQDIIHKVTDIQTNL
Download sequence
Identical sequences Bm1_56165 XP_001902691.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]