SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_56170 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_56170
Domain Number 1 Region: 330-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 237-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000502
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  Bm1_56170
Domain Number - Region: 191-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0655
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_56170
Sequence length 395
Comment | Brugia malayi Delta serrate ligand family protein (396 aa)
Sequence
MPLRHRKQNIEPLIRRKDCSCAGSFEIRLVSLTVGSKEEFRPELRICLKHFEKRISYNGE
CTFGEVTLDAERLRNGTKIEFQFGWPESFTLITEAWRTTGNLKKLMSHNGFQRESIPSGK
TWIEETLVGTNGFRMRIAYRITCANDYYGPRCLTFCQPMSSTVGHFQCTSNGSLACSPGW
EGSSCDIARCDNCINGACDRPDSCRCKTGWTGPNCDQCVRYPGCKHGTCKTPNQCICDEG
WGGHFCNEDLNYCTRHHPCRNNATCRNTGHGQYTCECPDGYTGTDCEIRVQNCSLQPCLN
GATCSDMPGNTYICTCSKGFTGRYCQVAATSCSDSPCQNGATCAEIGGVFLCTCLQGWTG
TTCDIEINPCDKSQQGGALASASWIAQRFSDVFAC
Download sequence
Identical sequences Bm1_56170 XP_001902692.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]