SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_57185 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_57185
Domain Number 1 Region: 94-176
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.36e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 38-95,171-213
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000103
Family WD40-repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_57185
Sequence length 216
Comment | Brugia malayi Hypothetical WD repeats containing protein
Sequence
DXXXXXXinchromosomeIIXputativeXXXXaaXMWDIGGKKGQAFELNAHNSRLTC
LRYAQHKKRLFSADEDGSLVCWDMTAKRVETPGWKTSDSCQLCDSPFFWNFREMWNKKVV
GLRQHHCRTCGNAVCAKCCSSTTRYPPMGYELPVRICNTCQSRMQQFPDQFDLTSLAVIS
ELRQGIMCMHLQESTGRLVTAGSDRILMIWDVKQLV
Download sequence
Identical sequences Bm1_57185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]