SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_02990 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_02990
Domain Number 1 Region: 126-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 2 Region: 182-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000879
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 238-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family EGF-type module 0.069
Further Details:      
 
Weak hits

Sequence:  Bm1_02990
Domain Number - Region: 90-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family EGF-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_02990
Sequence length 327
Comment | Brugia malayi protein unc-52, putative (328 aa)
Sequence
GNDISLQYTNHQPIYADRENTIEVVLFEDHWQRMDGQLATREHLLMALADLDSLLIKMSY
TDDCSSSSLISVSLDYAEPHATGGEIAYEVEQCQCPPGYIGTSCEDCAPGYSRTGGGLYL
GLCERCECHGHASQCDKEHGFCLDCQHNTEGDQCERCKPGFTGDARRGTPHDCQPAATRP
PCMCNNHSPRGCDSFGRCLLCEHNTEGYHCEQCKRGFYGDALRGTPFDCTPCPCPGTSDC
FLDTYGQVQCRNCPAGLTGRLCEECAPGYTRSRSRARIDEGRICEPIGHVEETNIVFVPT
PEGDRKRKRRFRLQRKFFLNKKKKKKK
Download sequence
Identical sequences XP_001892093.1.25112 Bm1_02990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]